SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000022814 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000022814
Domain Number 1 Region: 124-400
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.31e-60
Family Nuclear receptor ligand-binding domain 0.0000244
Further Details:      
 
Domain Number 2 Region: 76-149
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.09e-23
Family Nuclear receptor 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000022814   Gene: ENSCAFG00000024861   Transcript: ENSCAFT00000024577
Sequence length 414
Comment pep:novel chromosome:CanFam3.1:X:87521487:87523637:1 gene:ENSCAFG00000024861 transcript:ENSCAFT00000024577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKVTDTGPPPQDEMPGSQGSQVLQVPPGPDPPPPSAQYEPQTPSKEGPARTLEPQLQPQ
PQPQLQPQPRAQGQPPINCLVCGDKSSGKHYGQFTCEGCKSFFKRSVGKNLTFTCQANQD
CRVDQYRRNQCQFCRLKKCIDVGMKREAVHRNRMLPAPPPQGQFTLANGEILNSQTNLSG
YISLLIHAEPYPLSGSGSQDVQPNDVLILENICEQAARVLFGAVEWARKIPFFPDLEVND
QVALLHLTWCDLFMLNWAQCSMPAQVLPFLAATSLHTSPGSSDQVAVFTENVQMLQDQME
KFKALHVDPAEYSCLKAIILFAPDAPGLSDTVNVESWQEKSQCALEQYVRRQYSNQPMRF
GKLLLRLTSLRAVPSSVVEQLFFVHLVGKTPIKILIRDILLSGGSGDWKKISRM
Download sequence
Identical sequences F6Y5T4
ENSCAFP00000022814 ENSCAFP00000022814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]