SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023125 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023125
Domain Number 1 Region: 301-516
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.11e-52
Family DBL homology domain (DH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 818-1116
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000000243
Family WD40-repeat 0.022
Further Details:      
 
Domain Number 3 Region: 529-612,706-764
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000637
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023125   Gene: ENSCAFG00000015727   Transcript: ENSCAFT00000024924
Sequence length 1276
Comment pep:known_by_projection chromosome:CanFam3.1:2:80667771:80775317:-1 gene:ENSCAFG00000015727 transcript:ENSCAFT00000024924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSNPPPQAAIEDQLVPGGPGPSPEAEDDPGEAFEFDDSDDDEDTSAGLGVPGLAPEKD
IEDAPLIHLDSAPTTDPDPAASPPQTEVPPVVSNGDAAFSGVRRSSWKRKSSRRIDRFTF
PALEEDVIYDDVPCETLDAHQPGVERNLLYEDVHRDGGPREAEDLGWSSSEFESYSEDSG
EETKPEAEPTKHRVSFQPKLSPDLTRLKERCARTKKDILALRAGGRDMQALKHKYDCKMT
QLMKAAKSGTKDGLEKTRIAVMRKVSFLHRKDVLGDSEEEDMGLLEVSVTDIKPPAPELG
PMPDGLSPQQVVRRHILGSIVQSEGSYVESLKRVLQDYRNPLMEMEPKVLSARKCQVVFF
RVKEILHCHSMFQIALSSRVAEWDSTEKIGDLFVASFSKSMVLDVYSDYVNNFTNAMSII
KKACLTKPAFLEFLKRRQVCSPDRVTLYGLMVKPIQRFPQFILLLQDMLKNTPRGHPDRL
SLQLALTELETLAEKLNEQKRLADQVAEIQQLTKSVSDRSSLNKLLTSGQRQLLLCETLT
ETVYGDRGQLIKSKERRVFLLNDMLVCANINFKPANHRGQLEISSLVPLGPKYVVKWNTA
LPQVQVVEVGQDGGSYDKDNVLIQHAGAKKASAVGQAQNKVYFGPPRLFQELQDLQKDLA
VVEQITFLISTLHGTYQNLNMTVAQDWCLALQRLMRVKEEEIHSANKCRLRLLLPGKPDK
SGRPISFMVVFITPNPLSKISWVNRLHLAKIGLREENQPGWLCPDEDKKSKAPFWCPILA
CCIPAFSSRGLSLQLGALVHSPVSCPLLGFSAVSTSLPQGYLWVGGGQEGAGGQVEIFSL
NRPSPRTVKSFPLAAPVLCMEYIPEPEEGESGDESHVATEPSATVHPTICLGLQDGSILV
YGSVDTGTQCLATCRSPGLQPVLCLRHSPFHLFAGLQDGTLAAYPRTSGGVPWDLESPPV
CLTVGPGPIRTLLSLEDAVWASCGPRVTVLDATSLQTQQSFEAHQDEAVSVTHMVKAGSG
VWMAFSSGSSIRLFHTETLEHLQEINIATRTTFLLPGQKHLCVTSLLICQGLLWVGTDQG
VIVLLPVPRLEGIPKITGKGMVSLNGHCGPVAFLAVATSILAPDILRSDQEEAEGPRAEE
DKPDGQAHEPAPAPASHVGRELTRKKGILLQYRLRSTAHLPGPLLSVREPAPADGSALEH
SEEDGSIYEMADDPDVWVRSRPCTRDAHRKEICSVAIISGGQGYRNFGSAPGGSGRPAPC
GETDSALLIWQVPLTL
Download sequence
Identical sequences F1PZ44
ENSCAFP00000023125 ENSCAFP00000023147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]