SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023147 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023147
Domain Number 1 Region: 263-478
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.72e-52
Family DBL homology domain (DH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 775-1073
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000000229
Family WD40-repeat 0.022
Further Details:      
 
Domain Number 3 Region: 491-569,663-721
Classification Level Classification E-value
Superfamily PH domain-like 0.000000039
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023147   Gene: ENSCAFG00000015727   Transcript: ENSCAFT00000024946
Sequence length 1233
Comment pep:known_by_projection chromosome:CanFam3.1:2:80666946:80805359:-1 gene:ENSCAFG00000015727 transcript:ENSCAFT00000024946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSNPPPQAAIEDQLVPGGPGPSPEAEDDPGEAFEFDDSDDDEDTSAGLGVPGLAPEKD
IEDAPLIHLDSAPTTDPDPAASPPQTEVPPVVSNGDAAFSGVRRSSWKRKSSRRTVDRFT
FPALEEDVIYDDVPCETLDAHQPGVERNLLYEDVHRDGGPREAEDLGWSSSEFESYSEDS
GEETKPEAEPTKHRVSFQPKMTQLMKAAKSGTKDGLEKTRIAVMRKVSFLHRKDVLGDSE
EEDMGLLEVSVTDIKPPAPELGPMPDGLSPQQVVRRHILGSIVQSEGSYVESLKRVLQDY
RNPLMEMEPKVLSARKCQVVFFRVKEILHCHSMFQIALSSRVAEWDSTEKIGDLFVASFS
KSMVLDVYSDYVNNFTNAMSIIKKACLTKPAFLEFLKRRQVCSPDRVTLYGLMVKPIQRF
PQFILLLQDMLKNTPRGHPDRLSLQLALTELETLAEKLNEQKRLADQVAEIQQLTKSVSD
RSSLNKLLTSGQRQLLLCETLTETVYGDRGQLIKSKERRVFLLNDMLVCANINFKGQLEI
SSLVPLGPKYVVKWNTALPQVQVVEVGQDGGSYDKDNVLIQHAGAKKASAVGQAQNKVYF
GPPRLFQELQDLQKDLAVVEQITFLISTLHGTYQNLNMTVAQDWCLALQRLMRVKEEEIH
SANKCRLRLLLPGKPDKSGRPISFMVVFITPNPLSKISWVNRLHLAKIGLREENQPGWLC
PDEDKKSKAPFWCPILACCIPAFSSRGLSLQLGALVHSPVSCPLLGFSAVSTSLPQGYLW
VGGGQEGAGGQVEIFSLNRPSPRTVKSFPLAAPVLCMEYIPEPEEGESGDESHVATEPSA
TVHPTICLGLQDGSILVYGSVDTGTQCLATCRSPGLQPVLCLRHSPFHLFAGLQDGTLAA
YPRTSGGVPWDLESPPVCLTVGPGPIRTLLSLEDAVWASCGPRVTVLDATSLQTQQSFEA
HQDEAVSVTHMVKAGSGVWMAFSSGSSIRLFHTETLEHLQEINIATRTTFLLPGQKHLCV
TSLLICQGLLWVGTDQGVIVLLPVPRLEGIPKITGKGMVSLNGHCGPVAFLAVATSILAP
DILRSDQEEAEGPRAEEDKPDGQAHEPAPAPASHVGRELTRKKGILLQYRLRSTAHLPGP
LLSVREPAPADGSALEHSEEDGSIYEMADDPDVWVRSRPCTRDAHRKEICSVAIISGGQG
YRNFGSAPGGSGRPAPCGETDSALLIWQVPLTL
Download sequence
Identical sequences E2QXL1
XP_013966764.1.84170 ENSCAFP00000023147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]