SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023166 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023166
Domain Number 1 Region: 806-816,843-1205
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 1.31e-96
Family Formin homology 2 domain (FH2 domain) 0.0000241
Further Details:      
 
Domain Number 2 Region: 276-356
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-22
Family PDZ domain 0.0045
Further Details:      
 
Domain Number 3 Region: 9-78
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000447
Family PDZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023166   Gene: ENSCAFG00000015751   Transcript: ENSCAFT00000024965
Sequence length 1221
Comment pep:known_by_projection chromosome:CanFam3.1:6:11835961:11870109:-1 gene:ENSCAFG00000015751 transcript:ENSCAFT00000024965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTSAAMPATNQGWPEDFGFRLGGSGPCFVLEVTEGSSAHAGGLRPGDQILEVEGLAVGGL
SRERLVRLARRCPRVPPSLGVLPSPDGDPGAGSRCASPTAAPRPARCGPGLSLGRELLRL
GRRKRPDAVHRERRRKAQEFSRKVDEILGDQPTAKERVFAALKQFAAEQQVDDLVWALTL
ELPLEARAPLLDNLRIFIPKKHRARFDEVVSQGLLGKLCRARRTQGAQRLRRSRSEERPE
RLLVSTRASAAPRRPDEPPPRKAASLLGGRAGPGGARRTVRVYKGNKSFGFTLRGHGPVW
IESVLPGSPADNASLKSGDRILFLNGLDMRNCSHDKVVSMLQGSGAMPTLVVEEGLVPFA
SDSDSLDSPNPSSALTSLQWVAEILPSSIRVQGRTFSQQLEHLLTPPERYGVCRALESFF
QHRNIDTLIVDVYPVLDTPAKQVLWQFIYQLLTYEEQELCQEKIACFLGYTAMTAEPEPE
LDLEPEPEPEPEPEPEPVPELQRRSSLRASSMCRRSLRSQGLEASLSCGPGDCPEMPLPL
IPGERQAGDGTSLPETPNPKMMSAVYAELESRLNSSFKGKVGTSSRSRASPPVPSPSGTA
GPRTLSSVSWPSERLLPSPCYYPLCSGGLASPSSSESHPYASLDSSRAPSPQPDPGPIHS
DSPPSPDPARPPSRRKLFTFSRPMRSRDTDRFLDVLSEQLGPRVTAVDDFLSPENDYEEM
SFHDDQGSFVTNERSSASECISSSEEGSSLTYSSISDHIPPPPLSPPPPPPLPFHDPKPS
SRTPDGPRGPAQTLAKPLAQLSHPVPPPPPPPLPPPVPCAPPMLSRGLGHRRSETSHMSV
KRLRWEQVENSEGTIWGQLGEDSDYDKLSDMVKYLDLELHFGTQKPTKPVPGPEPFRKKE
VVEILSHKKAYNTSILLAHLKLSPAELRQVLMSMEPRRLEPAHLAQLLLFAPDADEEQRY
QAFREAPGRLSEPDQFVLQMLSVPEYKTRLRSLHFQATLQEKTEEIRGSLECLRQASLEL
KNSRKLAKILEFVLAMGNYLNDGQPKTNKTTGFKINFLTELNSTKTVDGKSTFLHILAKS
LSQHFPELLGFAQDLPTVPLAAKVNQRALTSDLADLHGTISEIQDACQSMSPSSEDKFAM
VMTSFLDTAQPVLRALDGLQHEAMEELGRALAFFGEDSKATTSEAFFGIFAEFMSKFERA
LSDLEAGDGPRSSGMVSPLAW
Download sequence
Identical sequences F1PYK2
ENSCAFP00000023166 ENSCAFP00000023166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]