SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023203 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023203
Domain Number 1 Region: 32-127
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-26
Family SH2 domain 0.00000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023203   Gene: ENSCAFG00000015778   Transcript: ENSCAFT00000025003
Sequence length 346
Comment pep:known_by_projection chromosome:CanFam3.1:20:46320072:46326578:-1 gene:ENSCAFG00000015778 transcript:ENSCAFT00000025003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEARKLPPPLPPRLDWFVQTQVGQLAQGGVPAWFHGAISREDAENLLELQPLGSFLIRV
SHSHVGYTLSYKAQSCCRHFMVKLLDDGSFRIPGQEKTHASLDALVTFHQQQPVRPHGDL
LTQPCGQEDPVNVDYEDLFLYSNALTEEVTSPAHGPSKTSTRPALLHWPKGRKPAAEMDR
ASTQEATSPSPPKAPLAETRRKLWKNLKMLPQMGKRVQQQLTSHQTSMNSSSLWSSGPPV
VTHSSGARPGDTNCEDNVNTDCFVATPIASPSEPQDLRNRGDPSRRASRLASWSEATPST
RSWHQVVVRALSSKVSKSETKDLIEPQKDWLPEEYRPPPPFAPGYC
Download sequence
Identical sequences E2R732
ENSCAFP00000023203 9615.ENSCAFP00000023203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]