SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023309 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023309
Domain Number 1 Region: 282-468,541-588
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.67e-38
Family Phospholipase D 0.069
Further Details:      
 
Domain Number 2 Region: 62-195
Classification Level Classification E-value
Superfamily PX domain 0.0000000000000523
Family PX domain 0.0099
Further Details:      
 
Domain Number 3 Region: 604-698
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.000000000169
Family Polyphosphate kinase C-terminal domain 0.069
Further Details:      
 
Domain Number 4 Region: 207-312
Classification Level Classification E-value
Superfamily PH domain-like 0.00000902
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023309   Gene: ENSCAFG00000015843   Transcript: ENSCAFT00000025112
Sequence length 926
Comment pep:known_by_projection chromosome:CanFam3.1:5:31756433:31767065:-1 gene:ENSCAFG00000015843 transcript:ENSCAFT00000025112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATPDSLFPSGGDLDSSQLQMEPDEVDTLREGEDPADRMHPFLAIYDLQPLKMHPLVFA
PGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGAFTWTTKKKFRHFQELHRDLLRHKVL
MTLLPLARFGVAHPPAREAAADREIPSLPRVGPEGSTRHASSKQKYLENYLNRLLTMSFY
RNYHAMTEFLEVSRLSFIPDLGSKGLEGVIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLV
VKDSFLLYMCLETGSISFVQLFDPGFEVQVGKRSTEARYGVRIDTSHRSLILKCGSYRQA
RWWGQEITELAQGPGRDFIQLHRHDSYAPPRPATLARWFVNGAGYFAAVADAILQAQEEI
FITDWWLSPEIYLKRPAHSDDWRLDIMLKKKAEEGVRVSVLLFKEVELALGINSGYSKRA
LMLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDPS
EPAATQPPTLGLDCPGTPDLSQNRFFWLGKDYSNLIVKDWVQLDRPFEGPPDFIDRETTP
RMPWRDVGVAVHGLPARDLARHFIQRWNFTKTTKAKYKIPMYPYLLPKSTSTADQLPFTL
PGGQCATVQVLRSVDRWSAGTLESSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNK
VGDEIVDRILKAHKLGQCFRVYVLLPLLPGFEGDITTGGGNSIQAILHFTYRTLCRGEYS
ILHRLKAASECWGAAGRGVQALDPWAGRGLLFLQGSGAAREIIFFKCQSNGQRLKSSTGL
CVYFESPGRAPQNFSSIQALQGSSFDLVGTLSRSVILGADARPDLDLRDPVCDDFFQLWQ
DTAESNANIYEQIFRCLPSNATRSLRALREYVAVESLATVSPPLATSELTQVQGHLVHFP
LKFLEDESLLPPLGSKEGVMPLEVWT
Download sequence
Identical sequences F1Q2H6
ENSCAFP00000023309 ENSCAFP00000023309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]