SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023347 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023347
Domain Number 1 Region: 296-403
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-26
Family SH2 domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023347   Gene: ENSCAFG00000015877   Transcript: ENSCAFT00000025151
Sequence length 433
Comment pep:known_by_projection chromosome:CanFam3.1:4:29651821:29734014:1 gene:ENSCAFG00000015877 transcript:ENSCAFT00000025151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQILHDMYIDPELLAELSDVQKHILFYKMREEQLRRWREREAWEALAQAEGLRPPKVK
RAASDKHIQWLLGADGEVWVWIMGEGPGDKPYEEISEELIAERARLQAQREAEELWRQKE
AEITKKFRDALANEKARILAEKWKVEMEDRKAAKVLEERIREEFKRKEEEERKRGEEQIR
LQEEQRAKELYWTLKQAQLQSGTSEHEEREWEEQLRRSKAADEERSRGAQRARDEYRRHS
LRAIQKGTVAGLSSMFQELGQSHEQEARLYHHLPGPGPPPPLAIPVSRTWERPLRPVSRE
VIVRWFKEEQLPRRAGFERNTKSIAPWFHGIISREDAEDLLENMTEGAFLVRVSEKIWGY
TLSYRLQKGFKHFLVDASGDFYSFLGVDPNRHATLTDLIDFHKEEIITVSGGELLQEPCG
QRDSPPDYHLLFE
Download sequence
Identical sequences F6XW36
ENSCAFP00000023347 ENSCAFP00000023347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]