SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023362 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023362
Domain Number 1 Region: 576-709
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-43
Family Phosphotyrosine-binding domain (PTB) 0.000000662
Further Details:      
 
Domain Number 2 Region: 387-552
Classification Level Classification E-value
Superfamily PH domain-like 5.39e-35
Family Phosphotyrosine-binding domain (PTB) 0.016
Further Details:      
 
Domain Number 3 Region: 284-322
Classification Level Classification E-value
Superfamily WW domain 0.000000000108
Family WW domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023362   Gene: ENSCAFG00000015887   Transcript: ENSCAFT00000025166
Sequence length 759
Comment pep:known_by_projection chromosome:CanFam3.1:3:71626346:71826749:1 gene:ENSCAFG00000015887 transcript:ENSCAFT00000025166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEVLPGDSGVDTVAVFMASSGATDITNRNSPATPPNTLHLRSSHNELLNAEIKHTESKN
STPPKCRKKYALTNIQVAMGLSDPAAQPLLGSGSANIKLVKNGENQLRKAAEQGQQDPNK
NVSPTAVINITSEKLEGKEPHPCDSSGSEILPSQPRRTKSFLNYYADLETSTRELEQNLG
NQHGVVEEKSQPGQGQASTVIGNGEALPQKANKAQFSPEDGQVATVSSSPETKKDHPKTG
AKTDCALHRIQNLAPSDEESSWTTLSQDSASPSSPDETADIWSDHSFQTDPDLPPGWKRI
NDIAGTYYWHIPTGTTQWERPVSIPADLHGSRKGSLSSVTSSPTPEHEKQPWSDFAVLNG
GKINSDIWKDLHAATVNPDPSLKEFEGATLRYASLKLRNAPHADDDDSCSINSDPEAKCF
AVRSLGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDTL
SLVDPMDRSVLHSQPIASIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIAT
SLHEICSKIMAERKNAKALACSSLQERTNVNLDVPLQVDFPTPKTELVQKFHVQYLGMLP
VDKPVGMDTLNNAIESLMTSSNQEDWLSVNMNVADATVTVISEKNEEETLVECRVRFLSF
MGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAGNVSEAVQAACMLRYQKCLVARPPSQKV
RPPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTETP
Download sequence
Identical sequences F6XUS8
ENSCAFP00000023362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]