SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023444 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023444
Domain Number 1 Region: 345-546
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-49
Family DBL homology domain (DH-domain) 0.00031
Further Details:      
 
Domain Number 2 Region: 546-671
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000877
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Domain Number 3 Region: 686-747
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000984
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023444   Gene: ENSCAFG00000015945   Transcript: ENSCAFT00000025253
Sequence length 771
Comment pep:known_by_projection chromosome:CanFam3.1:2:81490240:81499963:1 gene:ENSCAFG00000015945 transcript:ENSCAFT00000025253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCGPPATLQSHLAGPRGTARRPVAVCQQESLSFAELPTLQPPSPVCLDLFPVTPEELRA
PGSRWSLGTPPPLQGLLWPPSPGVPDTEICTSGGMRPSRAGSWPHCPSAQPPALEGPWSP
QHPQPQRRASHGSEKKSAWRKMRVYQREELPGSPEAHTVFLEPGQATEQALSTEEPRPLE
LSAPSRVGLEGPERRRFSASELMTRLHSSLRLGRNSAARVLTPGSGPGVAREGTSFSPGD
PKSRPPARCTMGHDPHLRLGAGQLQCGTPVPGIILGATHPQLSPSPGKASGREWRRGEMR
LTRGGVRAWAAGGGEKERQGREGGWSARPRCPGWARTALFNPASTLTQAKFELITSEASY
IHSLSVAVGHFLGSAELSECLGVQDKQWLFSKLPEVKSTSERFLQDLEQRLEADVLRFSV
CDIVLHHCPAFRRVYLPYVTNQAYQERTYQRLLLENPKFPGILARLEESPVCQRLPLTSF
LILPFQRITRLKMLVENILKRTAQGSEDEDVATKAFDALKKLVQECNASVQSMKRTEELI
HLSKKIHFEGKIFPLISQARWLVRHGELVELAPLPAAPPAKLKLSSKAVYLHLFNDCLLL
SRRKELGKFAVFVHARMAELQVKDLSLKLQGIPGHVFLLQLLHGQHAKHQFLLRARTESE
KQRWISAMRPSSSQEDKEVFSEGQDRPQVQCVRTYKALQPDELTLEKTDILAVRTRTSDG
WLEGVRLADGEKGWVPQAHVEEIGSLNARLRNLRENKRITSATSKLGEPPT
Download sequence
Identical sequences E2R8Q4
ENSCAFP00000023444 ENSCAFP00000023444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]