SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023554 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023554
Domain Number 1 Region: 16-134
Classification Level Classification E-value
Superfamily PH domain-like 9.71e-52
Family Dcp1 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023554   Gene: ENSCAFG00000015993   Transcript: ENSCAFT00000025368
Sequence length 612
Comment pep:known_by_projection chromosome:CanFam3.1:27:43985219:44042310:-1 gene:ENSCAFG00000015993 transcript:ENSCAFT00000025368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAAGGLVGKGRDISLAALQRHDPYINRIVDVASQVALYTFGHRANEWEKTDVEGTLF
VYTRSASPKHGFTIMNRLSMENRTEPITKDLDFQLQDPFLLYRNARLSIYGIWFYDKEEC
QRIAELMKNLTQYEQLKAHQGTGAGNSPMILNSGEGKEVDILRMLTKAKDEYTKCKTCSE
PKQITSSSAIYDNPNLIKPIPVKPSENQQQRVPRPNQTLDSECQHLSLTALFGKQDKSPC
QEAVGSPQTIHQQQQQPLPMRQGVVRSLSYEEPRRHSPPSEKQLCPAIQKLMVRSADLHP
LSELPENRPCRNGSTHSAGEVFLGPVQPGSPHSVGTSQHVQSTSRTQSLLEKLQSAPRPA
NKYDPSTPAPASSAAPSLSTTVPTAAPGAPVKGLAAQAQVGYFNGSLTPQTLGHQTYGKE
QPTHPRPTLPLSGNQTSSSGVISPQELLKKLQIVQQEQQLHASNRPALAAKFPVVTQSSR
TGKALESWMDKTPSTEKQTPLFQATSPPHVPATLAPSLLMSPMVFTQPTCAPLKERDAGL
LPLGSQEPAATSSSLLLPLPTQEPPVITSSPLTRLQLQEALLYLIQNDDNFLNIIYEAYL
FSMTQAAMKKTM
Download sequence
Identical sequences E2R259
XP_534931.2.84170 ENSCAFP00000023554 ENSCAFP00000023554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]