SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023556 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023556
Domain Number 1 Region: 1064-1200
Classification Level Classification E-value
Superfamily Cyclin-like 9.53e-45
Family Cyclin 0.0000646
Further Details:      
 
Domain Number 2 Region: 1201-1321
Classification Level Classification E-value
Superfamily Cyclin-like 8.85e-32
Family Cyclin 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023556   Gene: ENSCAFG00000015996   Transcript: ENSCAFT00000025370
Sequence length 1330
Comment pep:known chromosome:CanFam3.1:X:42963183:43012122:1 gene:ENSCAFG00000015996 transcript:ENSCAFT00000025370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPLPSRSSKPETKKSRSSKIVPSGNNGQSEKRGENYQEKISSSSPRRLCKKRSAFEDL
TNASQSQPAQLKKEANKEFVKDVPKKIKGNTPALGLAKSNEVNMVSYKLESSPGVVSTTL
VPNITEKPLILERSTTSGTITTEEASFFRKPLILKEESTTEDTGLIKRSLFLKKFTNKGE
ISLMEKPTSVQEEADSNDEFVVKLITFGKKHKTEEVAITKGTLSLKKMCTYQEDLALQDI
TVEENSFFMEPTNFRKKPKTDDVTPTKKMLSLKKKKYITLGKVSRMKKPLVLQKTNSEDE
SPLIKEPLAFKKKPTKKETTFTLRPLSLKKYTTQGKMAHLKKPLESQNTSGEKALIKEPL
SFKKKPITKEESLFQEFSASQEKHTTDREVVLLKKPQVLQEEKDSKDKFLMEPMFLRKKC
TTKETNPTKKPLPIKKKCTIQGKMYYLKKPLVLQKTTPGEESFVKEPLSFKKNTTELSML
QEKYTTQEEVSVLKKALTLQKTLTEEESHLKEPLAFKKKHTTEEATPTKKLSSLKRKRFT
AQGKRSCLMKPLVLQTSSGEKTHIKEPLSFKKRSAIEESFFKESPVLQEKHTMQGEVALL
EKPGALQENVSSEDEFLMEPISFRKTHTTNEVVSTKEPLSLKKKKCTTQITMSICQELLD
LQNIISKDKASFFMEPVSLREKSLAEEVILTKTPLSLKKKEITQGKIFLLKKPLVSEKTT
SEEESLFKKLLPFNKKSTTEGEFLFQDPSVLQEKHTTPQEVSLSTKPLTLPEKTTTEEEP
YIKEPLTLEERPTTKEEFLSQEPFSLHAKPTNEDESLFWKALGLQKTQTKEDSLKKLLTL
QEKNTTDEESLLNKPSILKEELSTKVATSIEKELSLKKKPTAQGEVFLLKKQLALQENIT
NEESLIKQPLAFLKPSIEEAILRESLALQEKPRSEEETLFKEPLSFQEKPTLNEAFHFKE
IISLNEKHSTGKELSLKEPLALQENPTQKEDTSLEDSLILQVETSSRVPSTPPESRAGMS
SVGKLSTTSKSSVCESSSNKPSSSWGESSQKEMTPLEDIDRNHGDPFFNSIYAKDIFSYM
KEREEKFILKEYMNKQTDISSCMRAILVDWLVEVQMTFEMSHETLYLAVKLVDHYLMEVI
CKRDKLQLLGSTAFLIAAKFEEPCPPCVDDFLYICDDIYQRHEMLSMEISILQTLKFDIN
IPIAYHFWRRYARCLHASMKTLTLSRFICEMTLQEYDYVQERASKLAAGSFLLALYMMKL
RYWVPALEYYSGYKTSDLHPLVKQLNILLTLRPSNKLKTVYSKYSHQVFFEVTKIPPLDM
LKLEEILNYC
Download sequence
Identical sequences F1PYY2
XP_013966800.1.84170 ENSCAFP00000023556 ENSCAFP00000023556 9615.ENSCAFP00000023556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]