SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023598 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023598
Domain Number 1 Region: 280-414,641-820
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.11e-53
Family Diacylglycerol kinase-like 0.018
Further Details:      
 
Domain Number 2 Region: 2-124
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-22
Family Pleckstrin-homology domain (PH domain) 0.0072
Further Details:      
 
Domain Number 3 Region: 180-226
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000401
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00082
Further Details:      
 
Domain Number 4 Region: 111-171
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000568
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023598   Gene: ENSCAFG00000016018   Transcript: ENSCAFT00000025414
Sequence length 1058
Comment pep:known_by_projection chromosome:CanFam3.1:X:43045242:43166172:-1 gene:ENSCAFG00000016018 transcript:ENSCAFT00000025414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIFQKILKEGPLLKNCNSFKRWKLRYFLVRGQRLCFAHHPAFARFETIDLCQVALAESSC
RNLRHSFCVITPQRKVTLAAPNRKDMEEWINVIKTVQQGEIRKIPAAENNPFLVGMHYWY
SSHSPRTQHCNVCRESIPALSTNVIICEVCKVKSHKLCALRASKDCKWNTLSITDDLLMP
ADEVKTMPHQWVEGNISVSSQCAVCHENCGSYQRLQDFRCLWCNSTTLGPSRDGFSKECW
FGSHRTSVIPPTALSDPKGDGQLVVSSDFWNLDWSSACSCPLLIFINSKSGDHQGIVFLR
KFKQYLNPSQVFDLSKGGPEAGLCMFKNFARFRIVVCGGDGSVSWVLSLIDAFGLHERCQ
LAVIPLGTGNDLARVLGWGAFWNKNKSPVTILNKVEQASVRILDRWSVMIRETPRQTPLL
RGQVEMDVPRFEAAAIQYLESATTELNKILKAKYPTEMIIATRFLCSAVEDFVVDIVKAW
SRIKQNNTAIESVILKSDIMYDKLSILIDILAEEAAIEKSPIVYADGGKVDGKPFVPQID
HIAKCKLELATKARNLQKSLKLIIFQVEQVLDEQSRQTISVKNFTSTFFLEDDSEDISQM
SPRHRSHPGTLSSISSLKSEDLDNLNLEHLHFTPETIRFKERCVMNNYFGIGLDAKISLE
FNTRRDEHPGQYNSRLKNKMWYGLLGSKELFQRSYRKLEERVHLECDGEAISLPNLQGIV
VLNITSYAGGVNFWGSNTATTEYEAPAIDDGKLEVVAIFGSAQMAMSRIINLHHHRIAQC
REVMITIDGEEGIPVQVDGEAWVQRPGLIKIRYKNAAQMLTRDRDFENSMKMWECKHSEI
QAASQPQLDSQEFQDSLSDEEYAQMKHLAQLAENLISRLTDLSKVHQHVSVLMDSVNASA
NILNDMFYSQDSGSEAGAASCIPQETLSRNDAVDVTFSLKGLYDDTKAFLDENLLRNPED
EATLQTALETMNKEFEKLSKINWMNSILVPKEKSSDTDSRSIRLKVKFPKLGKTKLEEED
KPKSGQRVQGFIGRLWHYRNREDEAKDDDPPTSSGFQL
Download sequence
Identical sequences F1PYT6
ENSCAFP00000023598 ENSCAFP00000023598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]