SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023641 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023641
Domain Number 1 Region: 89-292
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.2e-59
Family DBL homology domain (DH-domain) 0.0000215
Further Details:      
 
Domain Number 2 Region: 277-399
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-33
Family Pleckstrin-homology domain (PH domain) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023641   Gene: ENSCAFG00000016048   Transcript: ENSCAFT00000025462
Sequence length 1214
Comment pep:known_by_projection chromosome:CanFam3.1:8:39138592:39154173:1 gene:ENSCAFG00000016048 transcript:ENSCAFT00000025462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVSASLRQDGSQERPVSLTSTTSSSGSSRDSRGAMEEPSGPEASAENGAGSPRGRHPAN
GDSGPSGWLSVRGPLSPFSSRAPAAPALKLSYLGRVVREIVETERMYVQDLRSIVEDYLL
KIIDTPGLLKPEQVSALFGNIENIYALNSQLLRDLDSCNSDPVAVASCFVERSQEFDIYT
QYCNNYPNSVAALTECMRDKQQAKFFRDRQELLQHSLPLGSYLLKPVQRILKYHLLLQEI
AKHFDEEEDGFEVVEDAIDTMTCVAWYINDMKRRHEHAVRLQEIQSLLINWKGPDLTIYG
ELVLEGTFRVHRVRNERTFFLFDKALLITKKRGDHFVYKGHIPCSSLMLIESTRDSLCFT
VTHYKHSKQQYNIQAKTAEEKRSWTHHIKRLILENHHTTIPQKAKEAILEMDSYYPSRYR
CSPERLKKAWSSQDEVSTHVRQGRRQSEPTRHLLRQLSEKARAAGMKEKGRKESEGPKSR
RRSSGRSPTSAEKRMSFESTSSLPEVEPVPDPEMEQEVFAAMEGPSIEEVPSDTESPEVL
ETQLDAHQDLLGLAPPGDMGDFVVVESTEDLKALSSEEEDEDVRAAQETESLLPPSVLDQ
ASIIAERFVSSFSRRSSLALEDGKASGFGSPRLISRSSSVLSLEGSEKGPAWHGSTTDSL
GSQLPPEVDATVGVAMESGPPVNGTEPPSPGCLAEPDRSSCKKKESTLSTRDRLLLDKIK
SYYENAEHHDAGFSIRRRESLSYIPKGLVRNSVSRFNSLPRPDPEPMAPLGHKRPVGSRP
PSWALFDLPGPSQASAGEPAPITDAEFRPSSEIVKIWEGMESAGESSRKGPGQGQANGFD
LHEPLFILEEHELGAITEESATASPESASPTERPSPAHLARELKELVKELSSGVQGELVA
PLHPRIVQLSHVMDGHVSERVKNKVYQLARQYSLRIKSKSVTARPPLQWGKVAPTVPCLQ
EEAGAPSGGTGKRKPVLPLLNHEQTAAQEHSPPKPGSPRLFAFSPTAASPKASSAAPRPS
SRSPLSPFDAEPFSWPDVRELCSKYASHDEAFQAEGSRPRGPPVNRSRSVPENMVEPPPA
GRVGRCCSVGARRGRPGPEAAQPQLPGMLPQSRPVEDEALYVTADLTLENNQRVIVLEKG
PLPCPAAGLEERSGQGPSSPAATMRRGLDFQETGVSRSPEYWPKEEGPRDPADPGQQGRV
RNLREKFQALNSIG
Download sequence
Identical sequences E2QX49
ENSCAFP00000023641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]