SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023863 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023863
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-43
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000144
Further Details:      
 
Domain Number 2 Region: 736-774
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.00000000000405
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000023863
Domain Number - Region: 145-248
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0664
Family Tandem AAA-ATPase domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023863   Gene: ENSCAFG00000016185   Transcript: ENSCAFT00000025695
Sequence length 776
Comment pep:known_by_projection chromosome:CanFam3.1:7:39178713:39247212:1 gene:ENSCAFG00000016185 transcript:ENSCAFT00000025695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVI
NCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQETVFYL
GPTLPRQNSQLPAQVQNGPSQEELEIQRRQLQEQQRQKELERERVERERVERVERERLEQ
EQLEREREREQRERERQDRLERERLERLDREREQRERQEQREREQRERQEQLEREQLEWE
RERERRLSAAAPSDSSPYSAPLPEYASCQPPSAPPPSYAKVISAPVSEATPDYAVVTALP
PTSTPPTPPLRHSATRFAASVGSAFHPVLPHYATVPRPLNKNSRPSSPVNTPSSQPPATK
PCAWSTSTVSPLPPSPPVMISSPPGKATGPRPVLPVCVSSPVPPMPPSPTAPNGPLDSVT
CPVSPPPTSGPAVPPPPPPLPSLAPRSHCGSQASPPPSTPIASTPSSKPSVLPSPSAAAP
ASAETPLNSVLGDSSASEPGLQAASQPAETPAQQGIVLGPPAPPPPPPLPPGPALAPAAL
PPHPGPPPPPPLPASGPPPPPPPPPLPNQAPPPPPPPPAPPLPASGFFAASASEDNRPLT
GLAAAIAGAKLRKVSRMEDASFPGGGVNPASSKSDTGRGNGPLPLGGSGLMEEMSALLAR
RRRIAEKGSTIETEQKEDKNEDSEPIISKASSTSTPEPTRKPWERTNTMNGSKSPVISRP
KSAPSSQPSANGVQTEGLDYERLKQDILDEMRKELTKLKEELIDAIRQELSKSNSA
Download sequence
Identical sequences F1Q0U7
ENSCAFP00000023863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]