SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023864 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023864
Domain Number 1 Region: 33-164
Classification Level Classification E-value
Superfamily RUN domain-like 8.63e-28
Family RUN domain 0.0015
Further Details:      
 
Domain Number 2 Region: 780-884
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-20
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023864   Gene: ENSCAFG00000016184   Transcript: ENSCAFT00000025696
Sequence length 1030
Comment pep:known_by_projection chromosome:CanFam3.1:2:81865792:81880743:-1 gene:ENSCAFG00000016184 transcript:ENSCAFT00000025696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEPVGVSGWCERVEVRFSVGHHGLQSYFAACEDETPAIRNHDKVLQRLCEHLDHALLYGL
QDLSSGYWVLVVHFTRREAIKQIEVLQHVATNLGRSRAWLYLALNENSLESYLRLFQENL
GLLHKYYVKNALVCSHDHLTLFLTLVSGLEFIRFDLDLDAPYLDLAPYMPDYYKPQYLLD
FEDRLPSSVQGSDSLSLNSFNSVTSTNLEWDDSAIAPSSEDYDFGDVFPAVPSVPSTDWE
DGDLTDTVSGPRSTASDLTSSKASTKSPTQRHNPFSEDPAETVSSSDTTPVHTTSQEKGE
PHTLDLPDACTELEVIRVTKKKKTGKKKKARLDEEASPLHPSSTQDSCARRGGDGDSLVS
SPGLGRASPDATFTPPQEEGEGPSSTAESSELSEPGPVGLLIPEMKDTSMERLGQPLSKV
IDQLNGQLDPSTWRSHAQSPDQSFRAGSPGDAPEKPPCCDFSEGLPAPMDFYRFTVESPS
TLTSGGSNHDPAGPGQPLHVPGSPETAGQEEGGGGREGQTPGPLERAPREAGGPEPRELD
PESPLVREGPVPEPEPGAREALCQLKRDRPSPCVSSAEDSGVDEGQGSPSDTTHSAEFRV
DNNHLLLLMIHVFRENEEQLFKMIRMSTGHMEGNLQLLYVLLTDCYVYLLRKGAAEKPYL
VEEAVSYNELDYVSVGLDQQTVKLVCTNRRKQFLLDTADVALAEFFLASLKSAMIKGCRE
PPYPSILTDATMEKLALAKFVAQESKCEATAVTVRFYGLVHWEDPMDESLGPVLCHCSPP
EGTITKEGMLHYKAGTSYLGKEHWKTCFVVLSNGILYQYPDRTDVTPLLSVNMGGEQCGG
CRRANTTDRPHAFQVILADRPCLELSAESEADMADWMQHLCQAVSKGVIPQGVTPSPCIP
CCLVITDDRLFTCHEDCQTSFFRSLGTAKLADISAVSTGPGKEYCVLDFSQDSQQPLLPW
VIYLSCTSELDRFLSALGSGWKTIYQVDLPHKPIQETSNKKFEDALSLIHSAWQRSDSLC
RGRASRDPWC
Download sequence
Identical sequences F1Q0U6
ENSCAFP00000023864 ENSCAFP00000023864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]