SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023923 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023923
Domain Number 1 Region: 33-397
Classification Level Classification E-value
Superfamily Serpins 5.5e-113
Family Serpins 0.0000000585
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023923   Gene: ENSCAFG00000016228   Transcript: ENSCAFT00000025757
Sequence length 397
Comment pep:known_by_projection chromosome:CanFam3.1:37:29697866:29730784:-1 gene:ENSCAFG00000016228 transcript:ENSCAFT00000025757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWHFSFFLVAAVTLPSVCSQFNPLSLEELGSNTGIQVFNQIVRSRPHDNVVVSPHGIAS
VLGMLQLGADGRTKKQLTTVMRYGVNGVGKVLKKINKAIGSKKNKDIVTVANAVFVKNGF
KMEVPFVTRNKDVFQCEVQNVSFEDPASACDSINVWVRNETRGMIDNLLSPNLIDGALTR
LVLVNAVYFKGLWKSRFQPENTKKRTFVTADGKSYQVPMLAQLSVFRCGSTSTPNDLWYN
FIELPYHGESISMLIALPTESSTPLSAIVPHISTKTIDSWMSAMVPKRVQVILPKFTAVA
QTDLKEPLKALGITEMFDPSKANFAKITRSENLHVSHILQKAKIEVSEDGTKASAATTAI
LIARSSPPWFIVDRPFLFFIRHNPTGAVLFMGQIYKP
Download sequence
Identical sequences F6Y2H4
ENSCAFP00000023923 XP_013966585.1.84170 ENSCAFP00000023923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]