SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023924 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023924
Domain Number 1 Region: 508-569
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000163
Family SH3-domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023924   Gene: ENSCAFG00000016231   Transcript: ENSCAFT00000025758
Sequence length 575
Comment pep:known_by_projection chromosome:CanFam3.1:8:39719875:39973831:1 gene:ENSCAFG00000016231 transcript:ENSCAFT00000025758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDL
RRMAESLRIPEGPIDQAPASGRVRALEEQLLKAKEQIENYKKQTRNGLGKDHEILRRRIE
NGAKELWFFLQSELKKLKNLEGNVLQRHADEFLSDLGHHERSIMTDLYYLSQTDGAGDWR
EKEAKDLTDLVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRT
LILESQNWRYATGGWETVFRPVSETCTDRSGTSTGHWSGEVKDKNVQVVELPIVDSLHPR
PPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVI
GVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKRRVYLATDDPSLLKEAKTK
YPTYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQ
TLHPDASANFHSLDDIYYFGGQNAHNQIAIYPHQPRTADEIPMEPGDIIGVAGNHWDGYS
KGVNRKLGRTGLYPSYKVREKIETVKYPTYPEAEK
Download sequence
Identical sequences F1PZQ9
NP_001005262.2.84170 XP_005623243.1.84170 XP_005623244.1.84170 XP_005623245.1.84170 XP_005623247.1.84170 XP_005623248.1.84170 XP_005623249.1.84170 XP_005623250.1.84170 XP_005623252.1.84170 XP_005623253.1.84170 XP_013971129.1.84170 XP_013971130.1.84170 XP_013971131.1.84170 ENSCAFP00000023924 9615.ENSCAFP00000023924 ENSCAFP00000023924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]