SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023942 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023942
Domain Number 1 Region: 4-287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-49
Family BAR domain 0.01
Further Details:      
 
Domain Number 2 Region: 407-521
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.97e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.00021
Further Details:      
 
Domain Number 3 Region: 260-361
Classification Level Classification E-value
Superfamily PH domain-like 1.61e-26
Family Pleckstrin-homology domain (PH domain) 0.0056
Further Details:      
 
Domain Number 4 Region: 586-693
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.71e-23
Family Ankyrin repeat 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023942   Gene: ENSCAFG00000016225   Transcript: ENSCAFT00000025778
Sequence length 740
Comment pep:known_by_projection chromosome:CanFam3.1:5:32292356:32305167:1 gene:ENSCAFG00000016225 transcript:ENSCAFT00000025778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVKLDFEECLKDSPRFRASIELVEAEVSELEARLEKLLKLGNGLLESGRHYLAAGRTFI
AGICDLARLGPPEPMMAECLDKFTTSLSHKLDSHAELLDATQHTLQQQIQTLAKEGLRGF
REARRDFWKGAESLEAALIHNAEVPRRRAQEAEEAGAALKTARAGYQGRALDYALQVPTP
TDPRASDPSEAGEGPXEAQAIHLQQDQEELMLTQYRRELGAQLHQLVLNSARERRDMEQR
HVLLKQKELGGEEPEPSLKEGPGGLVMEGHLFKRASNAFKTWSRRWFTIQSNQLVYQKKY
KDPVTVVVDDLRLCTVKLCPDSERRFCFEVVSPSKSCLLQADSERLLQLWISAVQSSIAT
AFSQAHLEDSPRGPGQGSGYPAMSSSATLGCGGMSRGRDPGGAGHVAAQVQSVDGNAQCC
DCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELVKLMCELGNVVI
NQIYEARVEAMAVKKPGPTCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRGGRGPSRGQPP
VLPKPSIRSQPGSCRARPAEPPSDDLGSLHPGALLFRAAGHPPSLPTMADALAHGADVNW
VNAARENATPLIQATAANSLLACEFLLQNGANVNQADNHGRGPLHHATILGHTGLACLFL
KRGADLGARDSEDKDPLTIAMETANADIVTLLRLAKMREVEAAQGQAGDETYLDIFRDFS
LMASDDPEKLSRRSHDLHTL
Download sequence
Identical sequences F1PZP3
ENSCAFP00000023942 ENSCAFP00000023942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]