SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000024052 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000024052
Domain Number 1 Region: 419-527
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-31
Family SH2 domain 0.000000632
Further Details:      
 
Domain Number 2 Region: 98-192
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.27e-30
Family Ras-binding domain, RBD 0.00000552
Further Details:      
 
Domain Number 3 Region: 230-343
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-16
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000024052   Gene: ENSCAFG00000016328   Transcript: ENSCAFT00000025903
Sequence length 530
Comment pep:known_by_projection chromosome:CanFam3.1:9:22742721:22751975:-1 gene:ENSCAFG00000016328 transcript:ENSCAFT00000025903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGLSPPHLSSSPEDLYLAPGTPPGTPPPPDAPLPGEVKRSQPLPIPTSRNLLREEELR
STSLPSIPNPFPELCSPPSQTPILGGSSGARGLLPRDASCPHVVKVYSEDGACRSVEVAA
GATARYVCEMLVQRAHALSDENWGLVECHPHLALERGLEDHESVVEVQAAWPIGGDSRFV
FRKNFAKYELFKSSPHSLFPEKMVSSCVDAHTGLSHEDLIQNFLNAGSFPEIQGFLQLRG
SGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNESNVYVVTEGRKLYGMPTDFG
FCIKPNKLRNGHKGLRVFCSEDEQSRTCWLAAFRLFKYGAQLYKNYQQAQSRHLRPSCVG
SPPLRSVSDNTLVAMDFSGHAGRVIENPREALSAALEEAQAWRKNHRLSLPTPGSGTSLS
AAIHRTQPWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLI
LPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL
Download sequence
Identical sequences E2QZ71
XP_005624607.1.84170 XP_548141.2.84170 ENSCAFP00000024052 9615.ENSCAFP00000024052 ENSCAFP00000024052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]