SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000024063 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000024063
Domain Number 1 Region: 4033-4389
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.35e-130
Family Hect, E3 ligase catalytic domain 0.0000000327
Further Details:      
 
Domain Number 2 Region: 1662-1725
Classification Level Classification E-value
Superfamily WWE domain 3.79e-17
Family WWE domain 0.0024
Further Details:      
 
Domain Number 3 Region: 1348-1403
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000125
Family UBA domain 0.0057
Further Details:      
 
Domain Number 4 Region: 116-145,238-471,573-685
Classification Level Classification E-value
Superfamily ARM repeat 0.0000461
Family MIF4G domain-like 0.086
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000024063
Domain Number - Region: 100-179,276-468,1378-1436,1477-1611,1795-1878,1985-2035,2156-2191,2280-2303,2471-2507
Classification Level Classification E-value
Superfamily ARM repeat 0.0242
Family Armadillo repeat 0.085
Further Details:      
 
Domain Number - Region: 3523-3629
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0248
Family Phase 1 flagellin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000024063   Gene: ENSCAFG00000016311   Transcript: ENSCAFT00000025916
Sequence length 4396
Comment pep:known_by_projection chromosome:CanFam3.1:X:45234282:45403462:-1 gene:ENSCAFG00000016311 transcript:ENSCAFT00000025916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVDRTKLKKTPTEAPADCRALIDKLKVCNDEQLLLELQQIKTWNIGKCELYHWVDLLDR
FDGILADAGQTVENMSWMLVCDRPEREQLKMLLLAVLNFTALLIEYSFSRHLYSSIEHLT
TLLASSDMQVVLAVLNLLYVFSKRSNYITRLGSDKRTPLLTRLQHLAESWGGKENGFGLA
ECCRDLHMMKYPPSATTLHFEFYADPGAEVKIEKRTTSNTLHYIHIEQLDKISESPSEIM
ESLTKMYSIPKDKQMLLFTHIRLAHGFSNHRKRLQAVQARLHAISILVYSNALQESANSI
LYNGLIEELVDVLQITDKQLMEIKAASLRTLTSIVHLERTPKLSSIIDCTGTASYHGFLP
VLVRNCIQAMIDPSMDPYPHQFATALFSFLYHLASYDAGGEALVSCGMMEALLKVIKFLG
DEQDQITFVTRAVRVVDLITNLDMAAFQSHSGLSIFIYRLEHEVDLCRKECPFVIKPKIQ
RPSTTQEGEEMETDMDVADVTMESSPGSSVSVEHRLDVELRASSSSSSASISSGSGPGPR
PGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSLKHIISNAEYYGPSLF
LLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREVLGSLPNVFSALCLNA
RGLQSFVQCQPFERLFKVLLSPDYLPAMRRRRSSDPLGDTASNLGSAVDELMRHQPTLKT
DATTAIIKLLEEICNLGRDPKYICQKPSIQKADGTATAPPPRSNHAAEEASSEDEEEEEV
QAMQSFNSTQQNETEPNQQVVGTEERIPIPLMDYILNVMKFVESILSNNTTDDHCQEFVN
QKGLLPLVTILGLPNLPIDFPTSAACQAVAGVCKSILTLSHEPKVLQEGLLQLDSILSSL
EPLHRPIESPGGSVLLRELACAGNVADATLSAQATPLLHALTAAHAYIMMFVHTCRVGQS
EIRSISVNQWGSQLGLSVLSKLSQLYCSLVWESTVLLSLCTPNSLPSGCEFGQVDMQKLV
PKDEKAGTTQGGKRSDGEQDGTAASMDASTQGLLEGIGLDGDTLAPMETDEPTASDSKGK
SKITPAMAARIKQIKPLLSASSRLGRALAELFGLLVKLCVGSPVRQRRSHHAASTTTAPT
PAARSTASALTKLLTKGLSWQPPPYTPTPRFRLTFFICSVGFTSPMLFDERKYPYHLMLQ
KFLCSGGHNALFETFNWALSMGGKVPVAEGLEHSDLPDGTGEFLDAWLMLVEKMVNPTTV
LESPHSLPAKLPGGVQNFPQFSALRFLVVTQKAAFTCIKNLWNRKPLKVYGGRMAESMLA
ILCHILRGEPVIRERLSKEKEGSRGEEDTGQEEGGSRREPQVNQQQLQQLMDMGFTREHA
MEALLNTSTMEQATEYLLTHPPPIMGGVVRDLSMSEEDQMMRAIAMSLGQDIPMDQRAES
PEEVACRKEEEERKAREKQEEEEAKCLEKFQDADPLEQDELHTFTDTMLPGCFHLLDELP
DTVYRVCDLIMTAIKRNGADYRDMILKQVVNQVWEAADVLIKAALPLTTSDTKTVSEWIS
QMATLPQASNLATRILLLTLLFEELKLPCAWVVESSGILNVLIKLLEVVQPCLQAAKEQK
EVQTPKWITPVLLLIDFYEKTAISSKRRAQMTKYLQSNNNNWRWFDDRSGRWCSYSASNN
STIDSAWKSGETSVRFTAGRRRYTVQFTTMVQVNEETGNRRPVMLTLLRVPRLNKNSKNS
NGQELEKTLEESKEMDIKRKENKANDTPLALENTNTEKETSLEETKIGEILIQGLTEDMV
TVLIRACVSMLGVPVDPDTLHATLRLCLRLTRDHKYAMMFAELKSTRMILNLTQSSGFNG
FTPLVTLLLRHIIEDPCTLRHTMEKVVRSAATSGAGSTTSGVVSGSLGSREINYILRVLG
PAACRNPDIFTEVANCCIRIALPAPRGSGTASDDEFENLRIKGPNAVQLVKTTPLKPSPL
PVIPDTIKEVIYDMLNALAAYHAPEEAEKSDPKPGGMTQEVGQLLQDMGDDVYQQYRSLT
RQSSDFDTQSGFSINSQVFAADGASTETSTSGTSQGEASTPEESRDGKKDKEGDRTSEEG
KQKSKGSKPLMPTSTILRLLAELVRSYVGIATLIANYSYTVGQSELIKEDCSVLAFVLDH
LLPHTQNAEDKDTPALARLFLASLAAAGSGTDAQVALVNEVKAALGRALAMAESTEKHAR
LQAVMCIISTIMESCPSTSSFYSSATAKTQHNGMNNIIRLFLKKGLVNDLARVPHSLDLS
SPNMANTVNAALKPLETLSRIVNQPSSLFGSKSASSKSKSEQDAQGAAQDSNSNQQDPGE
PGEAEVQEEDHDVTQTEVADGDIMDGEAETDSVVIAGQPEVLSSQEMQVENELEDLIDEL
LERDGGSGNSTIIVSRSGEDESQEDVLMDEAPSNLSQASTLQANREDSMNILDPEDEEEH
TQEEDSSGSNEDEDDSQDEEEEEEEDEEDDQEDDEGEEGDEDDDDDGSEMELDEDYPDMN
ASPLVRFERFDREDDLIIEFDNMFSSATDIPPSPGNIPTTHPLMVRHADHSSLTLGSGSS
TTRLTQGIGRSQRTLRQLTANTGHTIHVHYPGNRQPNPPLILQRLLGPSAAADILQLSSS
LPLQSRGRARLLVGNDDVHIIARSDDELLDDFFHDQSTATSQAGTLSSIPTALTRWTEEC
KVLDAESMHDCVSVVKVPIVNHLEFLRDEELEERREKRRKQLAEEETKITDKGKEDKENR
DQSAQCTASKTNDSAEQNLSDGTPMPDSYPTTPSSTDAATSESKDTLVTLQPSQQQQTLP
PPPALGEIPQELQSPAGEGGSSTQLLMPVEPEELGPTRPSGEAETTQMELSPAPTITSLS
PERAEDSDALTAVSSQLEGSPMDTSSLASCTLEEAVGDTSAAGSSEQPTAGSSTPGDAPT
VVTEVQSRGDGSGEPTQPPEDSSPPASSESSSTRDSAVAISGADSRGILEEPLPSTSSEE
EDPLAGISLPEGVDPSFLAALPDDIRREVLQNQLGIRPPTRTAPSANSSAPAVVGNPGVT
EVSPEFLAALPPAIQEEVLAQQRAEQQRRELAQNASSDTPMDPVTFIQTLPSDLRRSVLE
DMEDSVLAVMPPDIAAEAQALRREQEARQRQLMHERLFGHSSTSALSAILRSPAFTSRLS
GNRGVQYTRLAVQRGGTFQMGGSSSHNRPSGSNVDTLLRLRGRLLLDHEALSCLLVLLFV
DEPKLNTSRLHRVLRNLCYHAQTRHWVIRSLLSILQRSSESELCIETPKLSSSEDKGKKS
SKSCGSSSHENRPLDLLHKMESKSSNQLSWLSVSMDAALGCRTNIFQIQRSGGRKHTEKH
ASSGSTVHIHPQAAPVVCRHVLDTLIQLAKVFPSHFTQQRTKETNCESDRERGSKQACSP
CSSQSTSSGICTDFWDLLVKLDNMNVSRKGKNSVKSVPVSAGGEGETSPYSLEASPLGQL
MNMLSHPVIRRSSLLTEKLLRLLSLISIALPENKVSEAQANSGSSASSTTVATSTTSTTT
TTAASSTPTPPAATTPVTSAPALVAATAISTIAVAASTTVTTPTTATTTVSTSTTTKASK
SPAKVGDGGSSSADFKMVSSGLTENQLQLSVEVLTSHSCSEEGLEDAANVLLQLSRGDPA
TRDTVLKLLLNGARHLGYTLCKQIGTLLAELREYNLEQQRRAQCETLSPDGLPEEQPQTT
KLKGKMQSRFDMAENVVIVASQKFFLRVLQVIIQLRDDTRRANKKAKQTGRLGSSGLGSA
SSIQAAVRQLEAEADAIIQMVREGQRARRQQQAATSESSQSEASVRREESPMDVDQPSPS
AQDTQSIGSDGTPQGEKEKEERPPELPLLSEQLSLDELWDMLGECLKELEESHDQHAVLV
LQPAVEAFFLVHATERESKPPVRDTRESQLAHIKDEPPPLSPAPLTPATPSSLDPFFSRE
PSSMHISSSLPPDTQKFLRFAETHRTVLNQILRQSTTHLADGPFAVLVDYIRVLDFDVKR
KYFRQELERLDEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDA
GGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAV
YDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEV
QEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRL
ISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQ
FVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRH
MLLLAIQECSEGFGLA
Download sequence
Identical sequences F6XKL7
ENSCAFP00000024044 ENSCAFP00000024063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]