SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000024134 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000024134
Domain Number 1 Region: 113-222
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.09e-27
Family DEP domain 0.00000241
Further Details:      
 
Domain Number 2 Region: 225-338
Classification Level Classification E-value
Superfamily PH domain-like 9.76e-26
Family Pleckstrin-homology domain (PH domain) 0.00000211
Further Details:      
 
Domain Number 3 Region: 5-96
Classification Level Classification E-value
Superfamily PH domain-like 6.17e-22
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000024134   Gene: ENSCAFG00000016394   Transcript: ENSCAFT00000025996
Sequence length 340
Comment pep:known_by_projection chromosome:CanFam3.1:8:41373564:41383939:-1 gene:ENSCAFG00000016394 transcript:ENSCAFT00000025996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGHIVHNWKARWFILRQNTLLYYKLDGGRKVTPPKGRILLDGCTITCPCLEYENRPLLIK
LKTQTSTEYFLEACSREERDAWAFEITGAIHAGQPGKVQQLHVLRNSFKLPPHISLHRIV
DKMHDSSSGIRPSPNMEQGSTYKKTFIGSSLVDWLISNNFSANRLEAVTLASMLMEENFL
RPVGVRSMGAIRSGDLAEQFLDDSTALYTFAESYKKKISSKEEMSLSTMELSGTVVKQGY
LAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSLVSALEDNGVPTGV
KGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKLT
Download sequence
Identical sequences F6X9S9
ENSCAFP00000024134 ENSCAFP00000024134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]