SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000024206 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000024206
Domain Number 1 Region: 200-410
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-56
Family DBL homology domain (DH-domain) 0.00033
Further Details:      
 
Domain Number 2 Region: 392-524
Classification Level Classification E-value
Superfamily PH domain-like 5.65e-29
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 3 Region: 653-749
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-22
Family Pleckstrin-homology domain (PH domain) 0.00069
Further Details:      
 
Domain Number 4 Region: 504-618
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.1e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000024206   Gene: ENSCAFG00000016444   Transcript: ENSCAFT00000026071
Sequence length 791
Comment pep:known_by_projection chromosome:CanFam3.1:X:46192058:46239118:-1 gene:ENSCAFG00000016444 transcript:ENSCAFT00000026071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRMPPPPEPIPPPPSRPLPADPRVAKGLAPRLEASSSSAAVSSLIEKFEREPVIVASDR
PASGPSPGSTEPAVLPQPLPQPPAPQLPEGEASRCLFLLAPGPRDGEKVPNRDSGIDSIS
SPSNSEETCFVSDDGPPSHSLGPGPPALASIPVPLADPHRPGSQEVDSDLDEEDDEEEDE
KDREIPVPLMERQESVELTVQQKVFHIANELLQTEKAYVSRLHLLDQVFCARLLEEARNR
SSFPADVVHGIFSNICSIYCFHQQFLLPELEKRMEEWDRYPRIGDILQKLAPFLKMYGEY
VKNFDRAVELVNTWTERSTQFKVIIHEVQKEEACGNLTLQHHMLEPVQRIPRYELLLKDY
LLKLPHGSPDSKDAQKSLELIATAAEHSNAAIRKMERMHKLLKVYELLGGEEDIVSPTKE
LIKEGHILKLSAKNGTTQDRYLILFNDRLLYCVPRLRLLGQKFSVRARIDVDGMELKESS
NLNLPRTFLVSGKQRSLELQARTEEEKKDWVQAINSTLLKHEQTLETFKLLNSTNREDED
TPPNSPNVDLGKRAPTPIREKEVTMCMRCQEPFNSITKRRHHCKACGHVVCGKCSEFRAR
LIYDNNRSNRVCTDCYVALHGVPGSSPACSQHTPQRRRSILEKQASVAAENSVICSFLHY
MEKGGKGWHKAWFVVPENEPLVLYIYGAPQDVKAQRSLPLIGFEVGPPEAGERPDRRHVF
KITQSHLSWYFSPETEELQRRWMAVLGRAGRGDTFCPGLTLSEDREMEEAPVAASGATAE
PSEAPQTRDKT
Download sequence
Identical sequences E2R4N9
ENSCAFP00000024206 ENSCAFP00000024206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]