SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000024280 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000024280
Domain Number 1 Region: 41-69,103-245
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.35e-25
Family G proteins 0.026
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000024280
Domain Number - Region: 38-76,235-321
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0351
Family Plasmid maintenance system epsilon/zeta, toxin zeta subunit 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000024280   Gene: ENSCAFG00000016503   Transcript: ENSCAFT00000026149
Sequence length 374
Comment pep:known_by_projection chromosome:CanFam3.1:X:47323478:47361976:1 gene:ENSCAFG00000016503 transcript:ENSCAFT00000026149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESDSERKTEKENLGPRMDPPIGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSII
FANYIARDTRRLGATILDRLHSLQINSSFSTYSLVDSVGNTKTFDVEHSHVRFLGNLVLN
LWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPD
AKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECACFRTSIWDETLYKAWSSIVYQ
LIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQCKEQRDAHRFEKISNIIKQFK
LSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEK
LERVDGPKQCLLMS
Download sequence
Identical sequences F6XMW7
XP_852073.1.84170 ENSCAFP00000024280 ENSCAFP00000024280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]