SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000024332 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000024332
Domain Number 1 Region: 95-308
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-60
Family DBL homology domain (DH-domain) 0.00000000253
Further Details:      
 
Domain Number 2 Region: 293-447
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-48
Family Pleckstrin-homology domain (PH domain) 0.0000000535
Further Details:      
 
Domain Number 3 Region: 9-111
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-20
Family SH3-domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000024332   Gene: ENSCAFG00000016540   Transcript: ENSCAFT00000026204
Sequence length 527
Comment pep:known_by_projection chromosome:CanFam3.1:X:49101000:49276670:-1 gene:ENSCAFG00000016540 transcript:ENSCAFT00000026204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPAS
FVRLWVNQEDGVEEGPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIK
HLKDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEI
GPCFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLL
TPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQW
QASVLDWEGEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDIL
YYKGRIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEIHLFFAKKLEEKIRWLRAF
REERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVNSARSIPPSYPPPQDPLNQGQY
LVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLQVAFLGVYEGVKTEHT
Download sequence
Identical sequences E2QY09
ENSCAFP00000024332 XP_013967168.1.84170 ENSCAFP00000024332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]