SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000024393 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000024393
Domain Number 1 Region: 4-188
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.04e-22
Family G proteins 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000024393   Gene: ENSCAFG00000016576   Transcript: ENSCAFT00000026266
Sequence length 237
Comment pep:known_by_projection chromosome:CanFam3.1:6:17715408:17716981:1 gene:ENSCAFG00000016576 transcript:ENSCAFT00000026266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQLPE
ASARLTRTLTIERRGVEIEEGGIKVKLTVVDTPGFGDSVDCSDCWLPVVRFIEEQFEQYL
RDESGLNRKNIQDSRVHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPK
ETQALKQKVCLVTSDLWPYMKPKVVIKPEISFDFFDLGKGSKMSQTTLQERVSEEGG
Download sequence
Identical sequences F1PGQ1
ENSCAFP00000024393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]