SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000024489 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000024489
Domain Number 1 Region: 9-736
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.79e-258
Family Motor proteins 0.0000000000132
Further Details:      
 
Domain Number 2 Region: 1044-1107
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-23
Family SH3-domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000024489   Gene: ENSCAFG00000016635   Transcript: ENSCAFT00000026368
Sequence length 1108
Comment pep:known_by_projection chromosome:CanFam3.1:30:24067625:24266036:-1 gene:ENSCAFG00000016635 transcript:ENSCAFT00000026368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKGAYRYHWQSHNVKHSGVDDMVLLSKITENAIVENLKKRYMDDYIFTYIGSVLISVN
PFKQMPYFGEKEIEMYQGAAQYENPPHIYALADNMYRNMIIDRENQCVIISGESGAGKTV
AAKYIMSYISRVSGGGPKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSP
GGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASAEQKHSLGITSMDYYYYLSL
SGSYKVDDIDDRREFQETLHAMNVIGIFAEEQTLVLQIVAGILHLGNISFKEVGNYAAVE
SEEFLAFPAYLLGINQDRLKEKLTSRQMDSKWGGKSESIHVTLNVEQACYTRDALAKALH
ARVFDFLVDSINKAMEKDHEEYNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELT
LKAEQEEYVQEGIRWTPIEYFNNKIVCDLIENKINPPGIMSILDDVCATMHAVGEGADQT
LLQKLQMQIGSHEHFNSWNQGFIIHHYAGKVSYDMDGFCERNRDVLFMDLIELMQSSELP
FIKSLFPENLQADKKGRPTTAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPRDWEE
SRVKHQVEYLGLKENIRVRRAGYAYRRIFQKFLQRYAILTKATWPSWRGDEKQGVLHLLQ
SVNMDSDQFQLGRSKVFIKAPESLFLLEEMRERKYDGYARVIQKSWRKFVARKKYVQMRE
EASDLLLNKKERRRNSINRNFIGDYIGMEEHPELQQFVGKREKIDFADTVTKYDRRFKGV
KRDLLLTPKCLYLIGREKVKQGPDKGLVKEVLKRKIEMERILSVSLSTMQDDIFILHEQE
YDSLLESVFKTEFLSLLAKRYEEKTQKQLPLKFSNTLELKLKKENWGPWSAGGSRQVQFH
QGFGDLAILKPSNKVLQVSIGPGLPKNSRPTRRNTIQNRGYPSGTQNANYPMRAAPPPPG
HHQNGVIKNQFVPHPHAPGNQRLNQKSLYTSMARPPLPRQQSTGSDRVSQTPESLDFLKV
PDQGAAGVRRQTTSRPPPAGGRPKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDI
IKEDPSGWWTGRLRGKQGLFPNNYVTKI
Download sequence
Identical sequences F1P7L9
ENSCAFP00000024489 XP_535500.3.84170 ENSCAFP00000024489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]