SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000024642 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000024642
Domain Number 1 Region: 44-113
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000685
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000024642
Domain Number - Region: 189-262
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0028
Family Ubiquitin-related 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000024642   Gene: ENSCAFG00000016762   Transcript: ENSCAFT00000026535
Sequence length 286
Comment pep:known_by_projection chromosome:CanFam3.1:3:91676922:91707242:-1 gene:ENSCAFG00000016762 transcript:ENSCAFT00000026535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRRRGRFVVAELVAVCVSSPSRRSGGRRPRRGPGFSTLCDEKPKMLTRKIKLWDINAHIT
CRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQYIGHDRTMQD
IVYKLVPGLQEAEMRKQRDFYHKLGMEVPGDVKGETCSAKQHLDPHRNGETKADDSSNKE
AAEEKQEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKLNLS
SFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMDLL
Download sequence
Identical sequences F1PGG1
ENSCAFP00000039954 ENSCAFP00000024642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]