SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000024756 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000024756
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily PH domain-like 4.24e-44
Family Phosphotyrosine-binding domain (PTB) 0.000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000024756   Gene: ENSCAFG00000016834   Transcript: ENSCAFT00000026650
Sequence length 609
Comment pep:known_by_projection chromosome:CanFam3.1:8:46621834:46682833:-1 gene:ENSCAFG00000016834 transcript:ENSCAFT00000026650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICED
AVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPD
RNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTA
TFDASRTTFTREGSFRVTTATEQAEREEIMKQIQDAKKAETDKTVVGSSVAPGNTAPSPS
SPTSPTLDATASLETNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINE
LPSTMQRKTDFPIKNAVPEVEGEAESISSLCSQITNAFSTPSEDPFSSAPMTKPVTVIAP
QSPAFQGTEWGQSSGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASSVPLQPVL
QPPPPTAITQPAPPFQGNAFLTSQPVPVGVVPPLQPAFVPTQSYPVANGLPYPAPNVPVV
GITPSQMVANVFGTAGHPQASQPQAAHPHQSPSLVKQQTFPQYETGSATASPFFKPPAQH
LNGSAAFNGVDDGRLASGDKHTEVPAGTFPVDPFEAQWAALESKSKQRTNPSPTNPFSSD
LQKTFEIEL
Download sequence
Identical sequences F6UX21
ENSCAFP00000024756 ENSCAFP00000024756 XP_013971517.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]