SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000024759 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000024759
Domain Number 1 Region: 7-213
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-48
Family Pleckstrin-homology domain (PH domain) 0.00000322
Further Details:      
 
Domain Number 2 Region: 293-356
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000932
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000024759   Gene: ENSCAFG00000016837   Transcript: ENSCAFT00000026653
Sequence length 363
Comment pep:known_by_projection chromosome:CanFam3.1:9:24412384:24700996:-1 gene:ENSCAFG00000016837 transcript:ENSCAFT00000026653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAVALPEEIRWLMEDAEEFLAEGLRNENLSTTARDHRDHILRGFQQIKTRYYWDLQPQG
GDQAESYLGQDSSDDNHSGTHGLPLTSDAPFLPDYQDEGMEDITRGAQELDNIIKQGYLE
KKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYSVRMAPYLRKDSKKE
SCFELTSQDRRSYEFTAANPAEARDWVDQISFLLKDLSSLTIPCEDEEEEEEEEETYDDI
DGFDAPNSGSQCRPIILPGSMGPKEPTKETEDDIYEVLPDEEHDLEEDQNGTPHKGVDYT
NYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLIGIVPKEYLTTAFEM
EEI
Download sequence
Identical sequences F1PDX8
XP_537665.3.84170 ENSCAFP00000024759 ENSCAFP00000024759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]