SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000024850 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000024850
Domain Number 1 Region: 216-452
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-56
Family DBL homology domain (DH-domain) 0.0000374
Further Details:      
 
Domain Number 2 Region: 452-572
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-31
Family Pleckstrin-homology domain (PH domain) 0.00059
Further Details:      
 
Domain Number 3 Region: 31-91
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000148
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000024850   Gene: ENSCAFG00000016889   Transcript: ENSCAFT00000026745
Sequence length 986
Comment pep:known chromosome:CanFam3.1:7:41834979:41850488:1 gene:ENSCAFG00000016889 transcript:ENSCAFT00000026745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSSEESVQQPGGEQSRAALLQNREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKSI
TAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNSTALQSVSLRSKTTPRERP
SSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFSDESPLGLRRILSQSTDSLNM
RNRALSVESLIDEGAEVIYSELMSDFETDERDFAADSWSLAVDSSFLQQQKKEVMKQQDV
IYELIQTELHHVRTLKIMTRLFRTGMLEELQLEPGVVQGLFPCVDELSDIHTRFLSQLLE
RRRQALCPGSTRNFVIHRLADLLISQFSGPSAERMRKAYSEFCSRHTKALKLYKELYARD
KRFQQFIRKVTRSAVLKRHGVQECILLVTQRITKYPVLINRILQHSHGTDEERQDLTTAL
GLVKELLSNVDQDVHELEKGARLQEIYHRMDPRAQAPVPSKGPFGREELLRRKLIHDGCL
LWKTATGRFKDVLMLLMTDVLVFLQEKDQKYIFPALDKPSVVSLQNLIVRDIANQEKGMF
LISAAPPEMYEVHTASRDDRSTWIRVIQQSVRVCPSREDFPLIETEDEAYLRRIKMELQQ
KDKALVELLREKVGLFAEMTHFQVEEDSGGVALPALPRGLFRSESLECPRGERLLQDAIR
EVEGLKDLLVGPGVELLLTPRDPALLVDPDSGGSTSPGVTANGEARNFNGSIELCRTDSD
SSQKDRNGNQLRAPQEEALQRLVNLYGLLHGLQAAVAQQDTLMEARFPEGPERREKLARA
NSRDGEAGRVGPAPVAPDKQATELALLQRQHALLQEELRRCRRLGEERATEAGNLEARLR
ESEQARALLEREAEEARRQLAILGQSEPPPAEAPWARRPLDPRRRSLPAGDALYLSFTPP
QPSRGHDRLDLSVTIRSVHRPFEDRERQELGSPEERLQDSSDPDTGSEEEGGGRLSPPHS
PRDFTRMQDIPEETESRDGEPMVSES
Download sequence
Identical sequences F1PBF2
ENSCAFP00000024850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]