SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000025113 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000025113
Domain Number 1 Region: 400-619
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-51
Family DBL homology domain (DH-domain) 0.00032
Further Details:      
 
Domain Number 2 Region: 610-740
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000486
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000025113   Gene: ENSCAFG00000017057   Transcript: ENSCAFT00000027013
Sequence length 842
Comment pep:known_by_projection chromosome:CanFam3.1:5:33098159:33110693:1 gene:ENSCAFG00000017057 transcript:ENSCAFT00000027013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQSLPAATPPTQKPPRIIRPRPPSRPRAAASPGPHHNGSSPQEPALTSNDAGTPMCTP
IHWDSPAASLKPPALLPPSASKASLDSQTSPDSPSSTPSPASRRSVSPEPVPRSPVPPPK
PSGSHTLPLLPTVGVPAQGGSASAPGTVRRLAGRFEWGAESRVQAADALELGPQGAADVN
GEREAPQVNLGSSGSQENGTLDAGLACPPCCPCVCHIGRPGLELRWVPVGGYEDGPRAFC
RASPLRASRSRPNPPSISLPPVVLTSYRSTAERKLLPPLKAPKPTWVRQDIAISGDPPKP
DLDLPSEDGIQTGDNPDEAPPSAPPAPVEGRDKEELEELKEQNWELPLQDEPLYQNYRAA
VLSEELWGVSEDGCPSPTNPGEAPTFARPPGPRNTLWQELPAVRASGLLDTLSPQERRMQ
ESLFEVVTSEASYLRSLRLLTDTFVLSQALRDTLTPRDHHTLFSNVQRVQGVSERFLGTL
LSRVRSSPHISDLCDVVHEHAVGPFSVYVDYVRNQQYQEETYSRLMDTNVRFSAELRRLQ
SLPKCERLPLPSFLLLPFQRITRLRMLLQNILRQTEEGSSRQENAQKALGAVSKIIERCS
AEVGRMKQTEELIRLTQRLRFHKVKALPLVSWSRRLELQGELTELGCRRGGVLFTSRPRF
TPLCLLLFSDLLLITQPKSGQRLQVLDYAHRSLVQAQQVPDPSGPPTFRLSLLSNHQGRP
THRLLQASSLSDMQRWLGAFPTPGPLPCSPDTVYEDCDCSQELCSEPSAPARTEGRGLES
RAPPRHPLKSPEGWLKGFPGAFPAQLVCEVTGEHERRKHLRQHQRLLEAVGPSSGSPSAP
PP
Download sequence
Identical sequences F6V5A2
ENSCAFP00000025113 XP_005620083.1.84170 XP_860396.1.84170 ENSCAFP00000025113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]