SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000025127 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000025127
Domain Number 1 Region: 188-528
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.34e-86
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000655
Further Details:      
 
Domain Number 2 Region: 528-660
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.11e-30
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0019
Further Details:      
 
Domain Number 3 Region: 51-180
Classification Level Classification E-value
Superfamily Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 1.28e-25
Family Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000025127   Gene: ENSCAFG00000017058   Transcript: ENSCAFT00000027027
Sequence length 660
Comment pep:known_by_projection chromosome:CanFam3.1:4:43237614:43260670:-1 gene:ENSCAFG00000017058 transcript:ENSCAFT00000027027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLVAQCSARLLQQEKEIKSLTAEIDRLKNCGCLEDSPDLEQLREENLKLKYRLKILRK
SLQAERTRPTKNMININSRLQEVFGCAIKAAYPDLENPPLIVTPSQQPKFGDYQCNSAMG
ISQMLKTKEQKVNPREIAENITKHLPDNECVERVEIAGPGFINVHLRKDFVSQQLTNLLV
NGVQLPALGENKKVVVDFSSPNIAKEMHVGHLRSTIIGESMCRLFEFAGYDVLRLNHVGD
WGTQFGMLIAHLQDKFPDYLTVSPPIGDLQAFYKESKKRFDTEEEFKKRAYQCVVLLQSK
NPDIIKAWKLICDVSRQEFNKIYDALDISLIERGESFYQDRMNDVVKEFEDKGFVQVDDG
RKIVFVPGCSVPLTIVKSDGGYTYDTSDLAALKQRLFEEKADMIIYVVDNGQSVHFQTIF
GAAQMIGWYDPKVTRVSHAGFGVVLGEDKKKFKTRSGETVRLIDLLEEGLKRSMDKLKEK
ERDKVLTAEELKAAQTSVAYGCIKYADLSHNRLNDYIFSFDKMLDDRGNTAAYLLYAFTR
IRSIARLANINEEMLQKAAQETKIVLDHEKEWKLGRCILRFPEILQKILDDLLLHTLCDY
IYELATTFTEFYDSCYCVEKDRQTGQVLKVNMWRMLLCEAVAAIMAKAFDILGIKPVQRM
Download sequence
Identical sequences E2QRR5
ENSCAFP00000025127 ENSCAFP00000025127 9615.ENSCAFP00000025127 XP_853102.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]