SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000025299 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000025299
Domain Number 1 Region: 319-446
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-25
Family SH2 domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000025299   Gene: ENSCAFG00000017182   Transcript: ENSCAFT00000027202
Sequence length 449
Comment pep:known_by_projection chromosome:CanFam3.1:7:42853089:42870814:1 gene:ENSCAFG00000017182 transcript:ENSCAFT00000027202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARWFKEFPLNLKTASERARPGGGGGRLRKNSEAGGAGPAPGKGRKNSAAELGSGRAGV
GAPRDSRPPRESLQGLIQAAAGKGRKNSRAADDEQHRGVARSAGCSSYIGRLVKVDAQEK
SGKSSASSTSSCSSSASSSPASLGPELDKGKIGRQPETVIILEDYADPYDAKRTKGQRDA
ERAGENDGYMEPYDAQQMITEIRRRGSKDPLVKALQLLEGACELGENSAKTETLAKRRSS
KELLGKPPQLYDTPYEPADAAPDRRARLPVEDERPAAEYEQPWEWKKEQIARALSVQFEG
SDRPSVKEDTVKQHQRQKSWTQKILKPAASDHSEGERVDPALPLGKQPWYHGAITRAEAE
SRLQPCKEAGYLVRNSESGNSKYSIALKTSQGCVHIIVAQTKDNKYTLNQTSAVFDSIPE
VVHYYSNEKLPFKGAEHMSLLHPVHSKLH
Download sequence
Identical sequences F1PQA7
ENSCAFP00000025299 XP_855101.1.84170 ENSCAFP00000025299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]