SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000025446 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000025446
Domain Number 1 Region: 200-307
Classification Level Classification E-value
Superfamily Cyclin-like 1.05e-19
Family Cyclin 0.019
Further Details:      
 
Domain Number 2 Region: 22-96
Classification Level Classification E-value
Superfamily Cyclin-like 0.00000000000771
Family Cyclin 0.024
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000025446
Domain Number - Region: 146-198
Classification Level Classification E-value
Superfamily Cyclin-like 0.00034
Family Cyclin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000025446   Gene: ENSCAFG00000017274   Transcript: ENSCAFT00000027359
Sequence length 445
Comment pep:novel chromosome:CanFam3.1:4:50435132:50462462:1 gene:ENSCAFG00000017274 transcript:ENSCAFT00000027359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVREINWDNVAVHKLQSESCFLVEKELKLPAFRAHSPLLKSRRFFVDILTLLSSHCQLCP
AARHLAVYLLDHFLDRYNITTSKQLYAVAVSCLLLARNSRVLLLPGCCCSEKCSVHIDLH
RIIPKSASSLPFTGHPPPSQPPLLSLTGKFEDREDHVPKLEQINSTRILSGQNFTLTKKE
LLNTELLLLEAFGWNLCLPTPAHFLDYYLLASVSQKDHHCHSWPTACPRKTKECLKEYAH
YFLEVTLRDHIFYKFQPSVVAAACVGASRICLQLSPYWTRDLQRISNYSLEHLSTCIEIL
LVAYDNVFKDAVAVKSQSLTMVPSRSPAPTQVLFQPPTYPTLSQPATTPALAQFQTQTPV
QDLCLAYRDSLQAHRSGSLLSGGSGLSLHTLYPTLQPLDVCPMSLPAPLSVQMAITAEPR
HCLATAYGSSYFSGSHAFPTGCFDR
Download sequence
Identical sequences F1PK86
ENSCAFP00000025446 ENSCAFP00000025446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]