SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000025891 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000025891
Domain Number 1 Region: 353-613
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-76
Family Protein kinases, catalytic subunit 0.000000000372
Further Details:      
 
Domain Number 2 Region: 6-146
Classification Level Classification E-value
Superfamily PH domain-like 1.73e-44
Family Pleckstrin-homology domain (PH domain) 0.0000583
Further Details:      
 
Domain Number 3 Region: 234-382
Classification Level Classification E-value
Superfamily SH2 domain 6.46e-32
Family SH2 domain 0.00000183
Further Details:      
 
Domain Number 4 Region: 175-256
Classification Level Classification E-value
Superfamily SH3-domain 7.22e-17
Family SH3-domain 0.000063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000025891   Gene: ENSCAFG00000017565   Transcript: ENSCAFT00000027842
Sequence length 620
Comment pep:known_by_projection chromosome:CanFam3.1:4:52902615:52966455:-1 gene:ENSCAFG00000017565 transcript:ENSCAFT00000027842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKTSLAYFENRHGKKRTLKGSIELSRI
KCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETKNNNSLVPMY
HPNFWMDGRWRCCAQMEKLAVGCAQYDPTKNASKKPLPPTPEDNRRSLREPEETIVIALY
DYQTNDPQELMLQRNEEYYLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNSLETYEWY
NKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIVSENNPCIKHYHIKETND
NPKRYYVAEKYVFDSIPLLINYHQHNGAGLVTRLRHPVCSWRQKAPVTAGLRYGKWVIDP
TELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIQEGAMSEEDFIEEAEVMMKLSHPKLVQ
LYGVCLEQAPICLVFEFMEHGCLSDYLRNQRGLFAAETLLGMCLDVCEGMAYLEEACVIH
RDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSD
VWSFGVLMWEVFSEGKIPYENRSNSEVVEDITTGFRLYKPRLASSNIYQIMNHCWKEKPE
DRPPFCRLLSQLAEIAESGL
Download sequence
Identical sequences E2RP25
ENSCAFP00000025891 ENSCAFP00000025891 XP_546277.3.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]