SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000025916 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000025916
Domain Number 1 Region: 72-165
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 4.18e-29
Family MED7 hinge region 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000025916   Gene: ENSCAFG00000017576   Transcript: ENSCAFT00000027867
Sequence length 233
Comment pep:known_by_projection chromosome:CanFam3.1:4:53002995:53003696:1 gene:ENSCAFG00000017576 transcript:ENSCAFT00000027867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLE
SQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVH
HLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEA
GMRVKTEPMDADDSNNCTGQSEQQRENSGHRRDQIIEKDAALCVLIDEMNERP
Download sequence
Identical sequences E2RK91
NP_001240828.1.84170 XP_005618915.1.84170 XP_005618916.1.84170 XP_005618918.1.84170 XP_013968236.1.84170 ENSCAFP00000025916 ENSCAFP00000025916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]