SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000025919 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000025919
Domain Number 1 Region: 6-101
Classification Level Classification E-value
Superfamily PH domain-like 4.55e-17
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.095
Further Details:      
 
Domain Number 2 Region: 173-630
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000178
Family Armadillo repeat 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000025919   Gene: ENSCAFG00000017570   Transcript: ENSCAFT00000027870
Sequence length 833
Comment pep:known_by_projection chromosome:CanFam3.1:8:62304113:62344147:-1 gene:ENSCAFG00000017570 transcript:ENSCAFT00000027870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDTRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINPNT
AYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEE
RFDDMSSPGLELPSCELSRLEEIAELVASSLPSPLRREKLALALENEGYIKKLLELFHVC
EDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEECIMDVIGCLEYDPALSQPRKHREFL
TKTAKFKEVIPISDPELKQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEI
VGMLQEDEKFLTDLFAQLTDEATDEEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNM
GILPALEVILGMDDTQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDVSKKLTEQKIT
NKDILLINLIIEHMICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLGFFYKH
CMHVLTAPLLANTTEDKPSKDDFQTAQLLALVLELLTFCVEHHTYHIKNYIINKDILRRV
LVLMASKHAFLALCALRFKRKIIGLKDEFYNRYIMKSFLFEPVVKAFLNNGSRYNLMNSA
IIEMFEFIRVEDIKSLTAHVIENYWKALEDVDYVQTFKGLKLRFEQQRERQDNPKLDSMR
SILRNHRYRRDARTLEDEEEMWFNTDEDDMEDGEAVVSPSDKTKNDDDIMDPISKFMERK
KLKESEEKEVLLKTNLSGRQSPSFKLSLSSGTKTSLTSQSPSTNLPGSPGSPGSPGSPGS
PGSVPKSTSQTAAITTKGGLVGLVDYPDDDEDDDEDEDKEDTLPLSKKAKFES
Download sequence
Identical sequences F1PKZ5
XP_005623804.1.84170 ENSCAFP00000025919 ENSCAFP00000025919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]