SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000025981 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000025981
Domain Number 1 Region: 382-505
Classification Level Classification E-value
Superfamily EF-hand 1.16e-47
Family EF-hand modules in multidomain proteins 0.00000905
Further Details:      
 
Domain Number 2 Region: 508-602
Classification Level Classification E-value
Superfamily EF-hand 1.45e-34
Family EF-hand modules in multidomain proteins 0.0000392
Further Details:      
 
Domain Number 3 Region: 584-670
Classification Level Classification E-value
Superfamily RING/U-box 8.24e-18
Family ZZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 220-341
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000117
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 5 Region: 344-381
Classification Level Classification E-value
Superfamily WW domain 0.0000000000116
Family WW domain 0.00021
Further Details:      
 
Domain Number 6 Region: 79-176
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000187
Family Spectrin repeat 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000025981   Gene: ENSCAFG00000017618   Transcript: ENSCAFT00000027938
Sequence length 957
Comment pep:known_by_projection chromosome:CanFam3.1:X:75171784:75217091:1 gene:ENSCAFG00000017618 transcript:ENSCAFT00000027938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPMVMQGCPYTLPRCHEWRAADKFHHSSSLRSTCPQPQVRAAATAPAPPQDGAGVSCLS
PKLFNGSVGAAGPLEPPAMNLCWNEIKKKSHNLRARLEAFSDHSGKLQLPLQEIIDWLSQ
KDEELSAQLPLQGDVALVQQEKETHAAFMEDVKSRGPYIYSVLESAQAFLSQHPFEELEE
PRSESKDTSPRQRIQNLSRFVWKQATVASELWEKLTARCVDQHRHIEHTLEQLLEIQGAM
EELSNTLTQAEGVRATWEPIGDLFIDSLPEHIQALKLFKEEFSPMKDGVKLVNDLAHQLA
ISDVHLSMENSRALEQINIRWKQLQVSIGERLKQLQDAHRDFGPGSQHFLSSSVQVPWER
AISPNKVPYYINHQAQTTCWDHPKMTELYQTLADLNNIKFSAYRTAMKLRRVQKALRLDL
VTLTTALEIFNEHDLQASEHVMDVVEIIHCLTALYERLEEERGILVNVPLCVDMSLNWLL
NVFDSGRSGKMRALSFKTGIACLCGTEVKEKLQYLFSQVANSGSQCDQRHLGVLLHEAIQ
VPRQLGEVAAFGGSNVEPSVRSCFRFSTGKPVIEASQFLEWVNLEPQSMVWLAVLHRVTI
AEQVKHQTKCSICRQCPIKGFRYRSLKQFNVDICQTCFLTGRASKGNKLHYPIMEYYTPT
TSSENMRDFATTLKNKFRSKHYFSKHPQRGYLPVQSVLEADYSETLASSPMLPHADTHSR
IEHFASRLAEMESQNCSFFNDSLSPDDSIDEDQYLLRHCSPITDREPTFGQQAPCSMATE
NKGDLEKILAHLEDENRILQSELRRLKWQHEEAVEAPTLAEGSAELAQDHRNEELLAEAR
ILRQHKSRLETRMQILEDHNKQLESQLQRLRELLLQPPTESDGNGSASSSLASSPQQSEG
SHPQEKGQTTPDTEAADDVGSKSQDVSLCLEDIMEKLRHAFPSVRSSDVTANTLLAS
Download sequence
Identical sequences E2RID6
ENSCAFP00000025981 XP_538105.4.84170 ENSCAFP00000025981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]