SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026021 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026021
Domain Number 1 Region: 1-403
Classification Level Classification E-value
Superfamily Serpins 1.31e-130
Family Serpins 0.0000000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026021   Gene: ENSCAFG00000024698   Transcript: ENSCAFT00000027978
Sequence length 404
Comment pep:known_by_projection chromosome:CanFam3.1:8:63324277:63348785:-1 gene:ENSCAFG00000024698 transcript:ENSCAFT00000027978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLALCTYFLWLSTSYLLTVQAKDPDTDVSTSSSHRDLAPKNVDFAFNLYRHLVASSPDK
NVFISPVSISMALAMLSLGACGYTRVQLLQGLGFNLTKMSEAEIHQGFRHLRHLLEKSDT
MLEMTMGNALFLDRSLELLEPFSADTKHYYDLEAWATDFQDGTGASRQINEYIKNKTQGK
IVDLLSKLDSSAMVILVNYIFFKGTWEHPFDPESTREEDFYVNETTVVRVPTMFQSSTIK
HLNDQVLPCQLVQLEYMGNGTVFFILPEEGKMDTVIAALSRDTIQRWSESFTRSQVNLYI
PKVSLSGAYDLRAILRDMGIADLLDNGADFSGMTREAQPKLSKVVHKAVLQLHEKGLEAA
GPAGVMPNVKSEPLAFHFNRPFIVMIFDHFTWSSLFLGKVVNPT
Download sequence
Identical sequences F1PHS2
ENSCAFP00000026021 XP_005623821.1.84170 XP_547960.2.84170 ENSCAFP00000026021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]