SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026040 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026040
Domain Number 1 Region: 12-419
Classification Level Classification E-value
Superfamily Serpins 7.86e-117
Family Serpins 0.000000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026040   Gene: ENSCAFG00000024668   Transcript: ENSCAFT00000027997
Sequence length 422
Comment pep:known_by_projection chromosome:CanFam3.1:8:63436652:63453390:-1 gene:ENSCAFG00000024668 transcript:ENSCAFT00000027997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPVWLWLLGAGILPSVHCQPFSAHGDKSLGVPHAPRDHLSSPDPAYHKITPTITNFALH
LYKQLAAETSGNIFFSPVSISTSLALLSLGAQVNTSTQILEGLGFNLTETPEADIHRGFQ
SLIHTLDLPSSKLELKVGNSLFLDKQLKPQQHFLDTIRELYGAFAFSANFTDSATTRRQI
NEYVRKQTYGQVADGLQEFTQDTLMVLLNYIFFKAKWKHPFSRYQTQKQESFSVNERTSL
HIPMMHQKEMHRFLYDQEMACTVLQIEYSGNAMALLILPDPGKMEQVEAALQPETLRKWD
QWLLPSLLDLHLPRFSISGTYNLEEILPLIGLTNIFNLEADLSGITEQLNKTISRVSHKA
TVDMNVWGTRAGAASSLLSQPQALNATLASQARFNRPFLVLLWEMTTQSLLFLGKVVNPA
AG
Download sequence
Identical sequences F1PHQ3
ENSCAFP00000026040 ENSCAFP00000026040 XP_855206.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]