SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026043 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026043
Domain Number 1 Region: 3-415
Classification Level Classification E-value
Superfamily Serpins 4.06e-131
Family Serpins 0.0000000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026043   Gene: ENSCAFG00000024137   Transcript: ENSCAFT00000028000
Sequence length 418
Comment pep:known_by_projection chromosome:CanFam3.1:8:63473091:63484237:-1 gene:ENSCAFG00000024137 transcript:ENSCAFT00000028000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACSFYRLFLIVSISAPIYCVPPPRAPSKGSPCMSSTRSTAASQLSSSNTDFAFRLYQRL
ILKTPDQNVFFSPLSVSACLAMLSLGARSATKTQILQGLGFNLTHLPESSIHQAFQHLLH
SLRVPGKDLDLRMGSVLFIKKELWLQTNFLDDVKRLYESKVFSTDFSSSSTAREKINSYV
EKETKGKVVNLIQSLEPLTVMVLVNHIFFKGKWEKPFNPGYTSKSSPFLVGKRTTVKVPM
MHQVEEFAFGVDAELKCSVLRMDYDEDTAAFFVLPGQGKMRQLEQALSSRTLRKWNHLLQ
KRWIEVFIPKFSLSASYDLETILPKMGIRDAFDKNADFSGITKRDFLQLSKATHKAVLDV
SEEGTEAAAATATKLIVRSKDGPSHTVVRFNRSFLLLLINRATDAILFLGKVENPTKF
Download sequence
Identical sequences F1PHQ1
ENSCAFP00000026043 XP_005623822.1.84170 XP_005623823.1.84170 XP_005623824.1.84170 XP_005623825.1.84170 XP_537544.2.84170 ENSCAFP00000026043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]