SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026044 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026044
Domain Number 1 Region: 6-420
Classification Level Classification E-value
Superfamily Serpins 3.01e-101
Family Serpins 0.00000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026044   Gene: ENSCAFG00000017659   Transcript: ENSCAFT00000028002
Sequence length 423
Comment pep:known chromosome:CanFam3.1:8:63457208:63462798:-1 gene:ENSCAFG00000017659 transcript:ENSCAFT00000028002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHRKMHLALSLALILCGLFNSIFCQVKQRSKWSIYPVSSWEVSPVHHKIEAGNKAFAHK
LFKTLLMEHPRKNIIFSPLSISASFAMLSLGTRSTTLTNLLEGLGFDLKVIKVWDVHHGF
QSVIQMLKQLNRAGHLMHRDMLFIDSNRKINSPFLWDTQAMYDVRARMIDFRDVVKTKKQ
INHFVAEKTHKRTKELITSLNPHTFLFLVDYVFFKGTWEMAFHSNLMHKEDFFVDKHTTV
PVDMIWKTGQMIYSRSEELFATMVKIPFVGNMSIVLVLPDVGQPDSAVKEIVVQRATLLQ
SSNMRWVHIIMPKFKISSKIDLKKILPKMGISNVFTTGANFSGITKEDFPTIFEAMHEAT
MEVSKEGKMDTSKDMDSRNTIACHTYTATPLVVKFNRPFFLFVEDWMTQRAILMGKVFNP
IAE
Download sequence
Identical sequences E2RNE2
ENSCAFP00000026044 ENSCAFP00000026044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]