SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026046 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026046
Domain Number 1 Region: 1-411
Classification Level Classification E-value
Superfamily Serpins 5.76e-127
Family Serpins 0.0000000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026046   Gene: ENSCAFG00000017661   Transcript: ENSCAFT00000028004
Sequence length 414
Comment pep:known_by_projection chromosome:CanFam3.1:8:63497430:63506088:-1 gene:ENSCAFG00000017661 transcript:ENSCAFT00000028004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPMLGLGLLFAGLLTVEGLLNSKSPVKYRGPKSQIQSWKGMKAAEGLIKRNTDFGCKLY
RKLASNSPRKNIFFSPLSISAAFSMLSLGAQDSTLDEIKQGFNFRNMPERDIHEGFHYLI
YRMNQGSQDLELHLRNTLFIDQKLQPEKKFLTNVKNLYSADTVPTNFQNLGDTRKQINDY
VSQKTQGKINNLIKNIDPGTVMLLTNCIFFRARWQHEFDPKITKEEDFFLDGNQRVKVPM
MFRGGMYETGYDEQLSCTILEMPYQGTISATFILPDEGKMKTVEEALKADTFDRWKKLIT
RRVVDVSLPRFSITGNYDLKRTLSYLGITKIFEEHGDLTRISPHRSLKVGEAVHEAVLKM
DEKGTEGAAGSGAQTLPMQTPLPVKLNKPFLVFIKDDVVSTIIFLGKIVNPTGK
Download sequence
Identical sequences E2RNE1
ENSCAFP00000026046 9615.ENSCAFP00000026046 ENSCAFP00000026046 XP_855210.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]