SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026064 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026064
Domain Number 1 Region: 37-341
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.83e-102
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000538
Further Details:      
 
Domain Number 2 Region: 348-522
Classification Level Classification E-value
Superfamily An anticodon-binding domain of class I aminoacyl-tRNA synthetases 7.59e-20
Family C-terminal domain of glutamyl-tRNA synthetase (GluRS) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026064   Gene: ENSCAFG00000017673   Transcript: ENSCAFT00000028022
Sequence length 524
Comment pep:known_by_projection chromosome:CanFam3.1:6:22276230:22296934:1 gene:ENSCAFG00000017673 transcript:ENSCAFT00000028022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLLKRLLWPVRPLAPLGRPVGRRAASVGADAGPAVRVRFAPSPTGFLHLGGLRTALYN
YIFAKKHQGSFILRLEDTDQTRLVPGAAENIEAMLEWAGIPPDESPRRGGPVGPYQQSQR
LELYAQATKALLESGAAYPCFCSPQRLDLLKKEALRNRQTPRRYDNRCRNLTQKQVAQKL
AKDPKPAIRFRLEGEAPAFQDLVYGWNRHEVASVEGDPVILKSDGFPTYHLACVVDDHHM
GISHVLRGSEWLVSTSKHLLLYQALGWQPPRFAHLPLLLNKDGSKLSKRQGDIFLEQFAA
ADFLPDALLDIITNCGSGFAENQMGRTLPELITQFDLTRITCHSALLDLDKLPEFNRLHL
CRLVSNETQRRQLVGKLQALVEETFGSQLQDRDVLDPAYVERIILLRQGHICRLQDLVSP
AHSYLWTRPAVGRVQLGTISEKVDAIAKRVLGILEAPSISLTQDMLNRELKKVSEGLEGT
RHSTVMQFLRVALSGQLQGPPVAEMMVSLGVKEVRERIQKVLSS
Download sequence
Identical sequences E2RMJ5
ENSCAFP00000026064 9615.ENSCAFP00000026064 ENSCAFP00000026064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]