SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026067 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026067
Domain Number 1 Region: 6-423
Classification Level Classification E-value
Superfamily Serpins 1.83e-127
Family Serpins 0.0000000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026067   Gene: ENSCAFG00000023610   Transcript: ENSCAFT00000028025
Sequence length 425
Comment pep:known_by_projection chromosome:CanFam3.1:8:63553854:63561366:1 gene:ENSCAFG00000023610 transcript:ENSCAFT00000028025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRAQKMDLADSLLLLLAGLLFLPHGQLHPERYSLHQEPPSTGEGSPSLKIAPGNTAFALH
FYHLMASQSPGSNIFFSPLSISASYAMLSLGARSHSKTQILEGLGFNLTEVSESDIHRGF
QHLLHTLHLPDDRLEMHMGSTLFLSQDLLILPEFLNDSVAFYDSKLFLTNFHDPVGTTQL
INDHIKEETQGKIVDLVSKLNTDIAMVLVNYIYFKALWEKPFQPSMTTTQDFHVDENTVV
QVPMMLQDTAHHWYLNDRYLPCSVLRMDYKGNMTAFFILPNRGKMKQVEEALTPEMLTRW
NRLLQKRHFYRKLELHFPKFSISGSYQLNEILPKMGFVDLFSRQVDLSGITKEKKLQVSK
SFHKAILEVDEVGTQAAAATGIFTTFLSAWHNHRVLWFNRPFFVVIFSTNTQSILFLGKV
VNPTK
Download sequence
Identical sequences F1PHN8
ENSCAFP00000026067 ENSCAFP00000026067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]