SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026080 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026080
Domain Number 1 Region: 3-407
Classification Level Classification E-value
Superfamily Serpins 9.43e-128
Family Serpins 0.000000000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026080   Gene: ENSCAFG00000029000   Transcript: ENSCAFT00000028038
Sequence length 407
Comment pep:known_by_projection chromosome:CanFam3.1:8:63567140:63577068:1 gene:ENSCAFG00000029000 transcript:ENSCAFT00000028038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLCLLLCLMLFSSPGTSIHRHRPRETKKRVKEPPVASTVAPASRDFAFDLYRALATAAP
DQNIFFSPLSISTTLAMLSLGAGSSTKVQILEGLGLHPQEGLEEALHRRIHQLLWDFAQP
REDIQLSLGNALFISPTVRLQDTFLQAVKMLYLADTFPTNFGDPAGAQKQINDYVAKQTK
GKIVDLAKDLDSTEAMVMVNYIFFKAKWETGFNHKSTRKQDFHVTSEMVVQVPMMKQEDH
YYYYVDRNLSCRVVGVPYRGNATALFVLPGEGQMGQLENGMSEKTLKKWLKMFTKRQLEL
YLPKFSIEGSYQLDKVLPTLGIKDVFTSHADLTGMTNDTNIQVSEMVHKAMVEVDESGTQ
AAAATEAIFMFKSAPMRPHKIMFNRPFMMLIVENATNILFLGKVTHP
Download sequence
Identical sequences E2RMF9
ENSCAFP00000026080 ENSCAFP00000026080 XP_005623827.1.84170 XP_005623828.1.84170 XP_537545.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]