SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026084 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026084
Domain Number 1 Region: 382-648
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.42e-77
Family Protein kinases, catalytic subunit 0.000000000303
Further Details:      
 
Domain Number 2 Region: 4-168
Classification Level Classification E-value
Superfamily PH domain-like 9.53e-53
Family Pleckstrin-homology domain (PH domain) 0.0000000309
Further Details:      
 
Domain Number 3 Region: 251-378
Classification Level Classification E-value
Superfamily SH2 domain 3.42e-33
Family SH2 domain 0.000041
Further Details:      
 
Domain Number 4 Region: 206-274
Classification Level Classification E-value
Superfamily SH3-domain 1.74e-19
Family SH3-domain 0.0000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026084   Gene: ENSCAFG00000017669   Transcript: ENSCAFT00000028042
Sequence length 659
Comment pep:known_by_projection chromosome:CanFam3.1:X:75271380:75302763:-1 gene:ENSCAFG00000017669 transcript:ENSCAFT00000028042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTMHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPTAAPASTSELKKVVALYDYMPMNANDLQLRKGEE
YFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRNRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FTNSETAEHIAQGLRLYRPHLASERVYTIMYSCWHEKAEERPTFKILLSNILDVMDEES
Download sequence
Identical sequences E2RMF7
ENSCAFP00000026084 XP_005641623.1.84170 XP_549139.2.84170 ENSCAFP00000026084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]