SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026086 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026086
Domain Number 1 Region: 30-447
Classification Level Classification E-value
Superfamily Serpins 5.24e-134
Family Serpins 0.000000000413
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026086   Gene: ENSCAFG00000017675   Transcript: ENSCAFT00000028044
Sequence length 450
Comment pep:known chromosome:CanFam3.1:8:63588254:63596747:1 gene:ENSCAFG00000017675 transcript:ENSCAFT00000028044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKIQHSGQAVALESTEYVQLPPGKQRTEGMSPLLALGLLVAGLCPTVHCLPEGMRDPENV
TQEDLPNETSENSLRLASSNTDFTLSLYKELASKSPDKNVIFSPMSISIALAFLSLGAQG
TTQTEILEGLKFNLTEIPDREIHRGFQHLLRALHQPSSELQLSVGNAMFVGEQLKLLETF
VEDARALYASEAFSTNFQNSAAAEKLINDYVKNRTQGKIVDLVKDLDLHTAVVLVNYIFL
KAKWKTPFDPRDTFKSKFQVSKSRSVKVPMMNLEDVWVPYFRDDALSCTVVELQYTSNDS
ALFVLPDEGRMEAVEAMLLPETLRRWTHSLQMRRIDNLYLPKFSISSSYNLEDVLPQLGV
REVFTNEADLSRVTGHKNLAVSQIVHKTLLDVTELGTEAAAATGSKVVFFSGKIGPLVTV
RFNRPFLFCIHHKDTENILFWGKVTNPNQA
Download sequence
Identical sequences F1PH87
ENSCAFP00000026086 ENSCAFP00000026089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]