SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026089 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026089
Domain Number 1 Region: 1-418
Classification Level Classification E-value
Superfamily Serpins 4.06e-134
Family Serpins 0.000000000413
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026089   Gene: ENSCAFG00000017675   Transcript: ENSCAFT00000028047
Sequence length 421
Comment pep:known chromosome:CanFam3.1:8:63588214:63599157:1 gene:ENSCAFG00000017675 transcript:ENSCAFT00000028047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPLLALGLLVAGLCPTVHCLPEGMRDPENVTQEDLPNETSENSLRLASSNTDFTLSLYK
ELASKSPDKNVIFSPMSISIALAFLSLGAQGTTQTEILEGLKFNLTEIPDREIHRGFQHL
LRALHQPSSELQLSVGNAMFVGEQLKLLETFVEDARALYASEAFSTNFQNSAAAEKLIND
YVKNRTQGKIVDLVKDLDLHTAVVLVNYIFLKAKWKTPFDPRDTFKSKFQVSKSRSVKVP
MMNLEDVWVPYFRDDALSCTVVELQYTSNDSALFVLPDEGRMEAVEAMLLPETLRRWTHS
LQMRRIDNLYLPKFSISSSYNLEDVLPQLGVREVFTNEADLSRVTGHKNLAVSQIVHKTL
LDVTELGTEAAAATGSKVVFFSGKIGPLVTVRFNRPFLFCIHHKDTENILFWGKVTNPNQ
A
Download sequence
Identical sequences F1PH86
ENSCAFP00000026089 XP_005623829.1.84170 XP_537546.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]