SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026206 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026206
Domain Number 1 Region: 37-196
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000422
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026206   Gene: ENSCAFG00000017766   Transcript: ENSCAFT00000028176
Sequence length 292
Comment pep:known_by_projection chromosome:CanFam3.1:7:53398763:53466467:1 gene:ENSCAFG00000017766 transcript:ENSCAFT00000028176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEETPPPGCSKPHLEKLTLGITRILESSPGVTEVTIIEKPPAERHMISSWEQKNNCMLPE
DVKNFYLMTNGFHMTWSVKLDEHTIPLGSMAINSISKLTQLNQSSVYSLPNAPTLADLED
DTLEASENQPEKPHFDSRSVIFELDSCNGNGKVCLVYKTGKPALAQDTEIWFLDRALYWH
FLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFNMYKPITYNTNLLAEETNSFV
NKLDPSRVFKSKNKTLIPKKKGPVQPPGGQKGPSGPPSTSKSSSSPGNPVRK
Download sequence
Identical sequences E2RDQ8
ENSCAFP00000026206 ENSCAFP00000026206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]